Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FTX4

Protein Details
Accession A0A0D2FTX4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-43KLKLKGVKDSKVDKKKKKKSKPKETDDGPGSBasic
NLS Segment(s)
PositionSequence
13-35KLKLKGVKDSKVDKKKKKKSKPK
113-125RRKRLEERLKREG
Subcellular Location(s) nucl 25, mito_nucl 13.833, cyto_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPGDYASIGSGKLKLKGVKDSKVDKKKKKKSKPKETDDGPGSAASAAEEDTFKDKSVVLRKFEYEDVKIAKEERRKMGLVDGEVVGSGAGIEEDEEREVVKTEAEKRYEEQRRKRLEERLKREGVKTHKERVEELNRYLSSLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.3
4 0.4
5 0.45
6 0.48
7 0.53
8 0.59
9 0.65
10 0.71
11 0.78
12 0.79
13 0.84
14 0.87
15 0.91
16 0.93
17 0.93
18 0.94
19 0.95
20 0.95
21 0.93
22 0.92
23 0.86
24 0.84
25 0.75
26 0.65
27 0.55
28 0.44
29 0.34
30 0.24
31 0.19
32 0.1
33 0.07
34 0.06
35 0.05
36 0.05
37 0.06
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.15
44 0.24
45 0.28
46 0.29
47 0.3
48 0.31
49 0.33
50 0.35
51 0.33
52 0.25
53 0.24
54 0.22
55 0.21
56 0.2
57 0.2
58 0.22
59 0.25
60 0.28
61 0.28
62 0.29
63 0.29
64 0.29
65 0.3
66 0.28
67 0.22
68 0.19
69 0.15
70 0.12
71 0.11
72 0.11
73 0.07
74 0.04
75 0.04
76 0.02
77 0.02
78 0.02
79 0.02
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.06
87 0.06
88 0.07
89 0.09
90 0.15
91 0.21
92 0.23
93 0.24
94 0.26
95 0.36
96 0.45
97 0.51
98 0.55
99 0.59
100 0.66
101 0.72
102 0.76
103 0.76
104 0.77
105 0.79
106 0.77
107 0.77
108 0.76
109 0.71
110 0.69
111 0.66
112 0.64
113 0.64
114 0.61
115 0.61
116 0.58
117 0.57
118 0.57
119 0.59
120 0.6
121 0.55
122 0.52
123 0.51
124 0.47
125 0.46
126 0.43
127 0.34
128 0.27
129 0.23
130 0.25
131 0.19
132 0.2
133 0.21
134 0.27
135 0.27