Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2ID44

Protein Details
Accession A0A0D2ID44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-33FTAEKVRTHKEKKRASKAQEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, cyto 8, E.R. 5, mito 1, plas 1, pero 1
Family & Domain DBs
Amino Acid Sequences MVALILAVGAAIYFTAEKVRTHKEKKRASKAQEALQHGLVEPVSIIDDTTPVGNPPPYHKGNLPPYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.06
3 0.08
4 0.09
5 0.14
6 0.22
7 0.31
8 0.4
9 0.47
10 0.55
11 0.64
12 0.73
13 0.8
14 0.8
15 0.77
16 0.79
17 0.75
18 0.71
19 0.68
20 0.61
21 0.52
22 0.44
23 0.38
24 0.28
25 0.24
26 0.17
27 0.11
28 0.07
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.06
39 0.08
40 0.11
41 0.12
42 0.18
43 0.25
44 0.27
45 0.31
46 0.34
47 0.42