Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2H7N9

Protein Details
Accession A0A0D2H7N9    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-117LDKPFPPGEKKRAMKKQQRRPSRPGESYAHydrophilic
NLS Segment(s)
PositionSequence
95-111PGEKKRAMKKQQRRPSR
Subcellular Location(s) nucl 19, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MSSGGAALQPTFQGHVATTQDALILFEACLQGHLSHVPRRPHDRERSTLIRSGSIFIYEENASGIKRWTDGVTWSPSRILGNFLVYRELDKPFPPGEKKRAMKKQQRRPSRPGESYARSDAGSFSDGQSGSYGPERTTTAEQERQLIGSLVDSYGFKQDGLVKKTMSVTVQGVTHHLVSYYHVNDVLSNQLRTPSQTENLQYIRPRAELTTKQSFRSPIEDVDELDNAPAPYNYRVNPAGYIQDYNKQQYYLPQNFPPMPQQAGAPPYGMGVPSMPTPYLQSPVTTPHLQQQRNDYGQYDQSAYNRTYDSLNNSIPSSSKSIPATPTTMPSMISDRGQSQPSMYPPINMQRPINNLSPVSADPRNPVPYRPSPYPVNTSPAQMDHTRQSQPSPHEMKYDDRRDSGKPQSQLYQSPRQPYYQDGAGQPIAPPPYPQQPQMGQWAGQNPTQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.18
4 0.18
5 0.18
6 0.16
7 0.17
8 0.16
9 0.16
10 0.12
11 0.1
12 0.09
13 0.1
14 0.11
15 0.1
16 0.1
17 0.11
18 0.1
19 0.11
20 0.17
21 0.19
22 0.26
23 0.33
24 0.4
25 0.46
26 0.55
27 0.62
28 0.67
29 0.73
30 0.73
31 0.73
32 0.74
33 0.74
34 0.69
35 0.66
36 0.58
37 0.51
38 0.45
39 0.41
40 0.33
41 0.27
42 0.22
43 0.17
44 0.19
45 0.15
46 0.14
47 0.13
48 0.13
49 0.11
50 0.12
51 0.14
52 0.11
53 0.12
54 0.14
55 0.14
56 0.15
57 0.18
58 0.22
59 0.27
60 0.28
61 0.29
62 0.28
63 0.28
64 0.28
65 0.25
66 0.23
67 0.17
68 0.21
69 0.22
70 0.22
71 0.24
72 0.22
73 0.24
74 0.23
75 0.24
76 0.2
77 0.19
78 0.22
79 0.23
80 0.29
81 0.35
82 0.4
83 0.46
84 0.54
85 0.6
86 0.66
87 0.74
88 0.78
89 0.81
90 0.84
91 0.87
92 0.87
93 0.91
94 0.89
95 0.87
96 0.87
97 0.86
98 0.8
99 0.76
100 0.75
101 0.68
102 0.65
103 0.6
104 0.5
105 0.4
106 0.36
107 0.29
108 0.23
109 0.19
110 0.15
111 0.12
112 0.14
113 0.14
114 0.14
115 0.14
116 0.12
117 0.12
118 0.15
119 0.15
120 0.11
121 0.13
122 0.14
123 0.17
124 0.19
125 0.22
126 0.25
127 0.29
128 0.3
129 0.31
130 0.31
131 0.28
132 0.26
133 0.22
134 0.15
135 0.11
136 0.1
137 0.07
138 0.07
139 0.07
140 0.07
141 0.09
142 0.09
143 0.08
144 0.09
145 0.15
146 0.21
147 0.25
148 0.27
149 0.24
150 0.26
151 0.27
152 0.27
153 0.22
154 0.17
155 0.14
156 0.14
157 0.15
158 0.13
159 0.14
160 0.13
161 0.13
162 0.11
163 0.1
164 0.08
165 0.09
166 0.13
167 0.13
168 0.12
169 0.12
170 0.12
171 0.12
172 0.13
173 0.17
174 0.15
175 0.14
176 0.14
177 0.16
178 0.16
179 0.17
180 0.2
181 0.16
182 0.16
183 0.19
184 0.2
185 0.23
186 0.24
187 0.25
188 0.23
189 0.23
190 0.22
191 0.2
192 0.19
193 0.16
194 0.21
195 0.22
196 0.27
197 0.35
198 0.35
199 0.35
200 0.37
201 0.38
202 0.34
203 0.33
204 0.28
205 0.19
206 0.21
207 0.21
208 0.19
209 0.19
210 0.17
211 0.13
212 0.12
213 0.11
214 0.08
215 0.08
216 0.07
217 0.07
218 0.08
219 0.11
220 0.11
221 0.14
222 0.15
223 0.15
224 0.16
225 0.15
226 0.16
227 0.15
228 0.16
229 0.13
230 0.18
231 0.19
232 0.21
233 0.21
234 0.19
235 0.18
236 0.22
237 0.3
238 0.31
239 0.33
240 0.32
241 0.36
242 0.36
243 0.37
244 0.35
245 0.28
246 0.23
247 0.2
248 0.18
249 0.17
250 0.18
251 0.17
252 0.13
253 0.11
254 0.1
255 0.1
256 0.09
257 0.07
258 0.05
259 0.06
260 0.06
261 0.07
262 0.07
263 0.07
264 0.09
265 0.1
266 0.13
267 0.12
268 0.12
269 0.12
270 0.17
271 0.21
272 0.2
273 0.2
274 0.24
275 0.33
276 0.34
277 0.35
278 0.39
279 0.42
280 0.43
281 0.43
282 0.37
283 0.31
284 0.32
285 0.31
286 0.25
287 0.19
288 0.18
289 0.21
290 0.2
291 0.2
292 0.18
293 0.17
294 0.17
295 0.17
296 0.21
297 0.23
298 0.23
299 0.22
300 0.22
301 0.22
302 0.21
303 0.21
304 0.21
305 0.17
306 0.2
307 0.21
308 0.23
309 0.26
310 0.27
311 0.29
312 0.24
313 0.26
314 0.24
315 0.23
316 0.21
317 0.2
318 0.21
319 0.19
320 0.19
321 0.18
322 0.18
323 0.21
324 0.21
325 0.2
326 0.18
327 0.21
328 0.22
329 0.27
330 0.25
331 0.22
332 0.24
333 0.32
334 0.36
335 0.35
336 0.35
337 0.33
338 0.38
339 0.41
340 0.42
341 0.37
342 0.32
343 0.3
344 0.3
345 0.26
346 0.27
347 0.25
348 0.23
349 0.23
350 0.28
351 0.34
352 0.32
353 0.34
354 0.37
355 0.42
356 0.48
357 0.5
358 0.49
359 0.48
360 0.52
361 0.57
362 0.51
363 0.48
364 0.42
365 0.4
366 0.37
367 0.33
368 0.32
369 0.27
370 0.28
371 0.29
372 0.33
373 0.34
374 0.33
375 0.36
376 0.39
377 0.41
378 0.48
379 0.48
380 0.44
381 0.46
382 0.47
383 0.52
384 0.55
385 0.59
386 0.53
387 0.51
388 0.53
389 0.52
390 0.58
391 0.59
392 0.57
393 0.52
394 0.52
395 0.55
396 0.56
397 0.6
398 0.6
399 0.6
400 0.57
401 0.62
402 0.6
403 0.56
404 0.53
405 0.49
406 0.47
407 0.42
408 0.41
409 0.34
410 0.37
411 0.35
412 0.34
413 0.3
414 0.29
415 0.26
416 0.22
417 0.24
418 0.23
419 0.31
420 0.35
421 0.37
422 0.39
423 0.41
424 0.44
425 0.5
426 0.49
427 0.41
428 0.41
429 0.45
430 0.41