Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2H2H7

Protein Details
Accession A0A0D2H2H7   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-124DLRPKQTRAIRRRLSKKDASRVTEKQKKKETHFPMRKYBasic
NLS Segment(s)
PositionSequence
89-117RPKQTRAIRRRLSKKDASRVTEKQKKKET
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVRSTNAKVKPGQLWGKSKDDLKKQLDELKTELGQLRVQKIAGGASSKLTRIHDLRKSVARVLTVINANQRHQLRLFYQKKKYLPLDLRPKQTRAIRRRLSKKDASRVTEKQKKKETHFPMRKYAVKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.58
4 0.57
5 0.58
6 0.57
7 0.58
8 0.59
9 0.57
10 0.56
11 0.55
12 0.59
13 0.56
14 0.51
15 0.45
16 0.4
17 0.35
18 0.32
19 0.3
20 0.23
21 0.24
22 0.23
23 0.23
24 0.19
25 0.19
26 0.17
27 0.16
28 0.15
29 0.13
30 0.12
31 0.1
32 0.11
33 0.12
34 0.12
35 0.14
36 0.14
37 0.17
38 0.19
39 0.26
40 0.28
41 0.31
42 0.33
43 0.36
44 0.37
45 0.35
46 0.34
47 0.27
48 0.22
49 0.2
50 0.19
51 0.15
52 0.14
53 0.17
54 0.17
55 0.17
56 0.22
57 0.22
58 0.21
59 0.2
60 0.22
61 0.2
62 0.3
63 0.38
64 0.41
65 0.47
66 0.52
67 0.54
68 0.58
69 0.58
70 0.56
71 0.54
72 0.55
73 0.6
74 0.6
75 0.67
76 0.64
77 0.63
78 0.61
79 0.61
80 0.62
81 0.59
82 0.64
83 0.63
84 0.69
85 0.78
86 0.8
87 0.81
88 0.81
89 0.82
90 0.81
91 0.81
92 0.76
93 0.74
94 0.74
95 0.76
96 0.76
97 0.74
98 0.74
99 0.75
100 0.78
101 0.77
102 0.8
103 0.79
104 0.81
105 0.83
106 0.79
107 0.8
108 0.79
109 0.78
110 0.72