Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BSZ8

Protein Details
Accession Q6BSZ8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-44LHLRNKKTDKTAKPRVRWTNDVHydrophilic
103-131GNDACCGNHKRKQKKPRKSTPNAYEKQPTHydrophilic
NLS Segment(s)
PositionSequence
112-121KRKQKKPRKS
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG dha:DEHA2D04730g  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSVNPSNNTTTSTETNTETRPILHLRNKKTDKTAKPRVRWTNDVVDNENMDKKKSKICCIFHPQREFGESSSESSDESSDESDHSDDGAGEGASNGASNGGSGNDACCGNHKRKQKKPRKSTPNAYEKQPTYKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.3
4 0.3
5 0.26
6 0.23
7 0.23
8 0.25
9 0.3
10 0.36
11 0.43
12 0.47
13 0.57
14 0.62
15 0.62
16 0.68
17 0.69
18 0.7
19 0.72
20 0.77
21 0.75
22 0.77
23 0.83
24 0.83
25 0.8
26 0.75
27 0.7
28 0.68
29 0.64
30 0.6
31 0.53
32 0.44
33 0.38
34 0.35
35 0.35
36 0.25
37 0.21
38 0.21
39 0.19
40 0.25
41 0.27
42 0.34
43 0.38
44 0.41
45 0.47
46 0.55
47 0.62
48 0.63
49 0.63
50 0.57
51 0.49
52 0.47
53 0.4
54 0.31
55 0.27
56 0.2
57 0.17
58 0.16
59 0.15
60 0.13
61 0.12
62 0.12
63 0.07
64 0.08
65 0.07
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.05
90 0.06
91 0.07
92 0.08
93 0.08
94 0.14
95 0.18
96 0.25
97 0.32
98 0.42
99 0.5
100 0.61
101 0.72
102 0.77
103 0.83
104 0.88
105 0.92
106 0.93
107 0.93
108 0.94
109 0.93
110 0.93
111 0.86
112 0.82
113 0.8
114 0.73
115 0.71