Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2G1K7

Protein Details
Accession A0A0D2G1K7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21METSRHPTKRLRGLRPSTARQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 5, cyto 4, extr 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences METSRHPTKRLRGLRPSTARQLYTATVTPVVDYASPVWSINASTKTVRAAEQIQRIAAISIIAGFRTIAFPIAEAEASLKSVVDRWTDQLRRFWVDLHTLPSSHPFWKIKVSRASYRHYDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.79
4 0.77
5 0.73
6 0.64
7 0.55
8 0.5
9 0.41
10 0.36
11 0.31
12 0.23
13 0.19
14 0.18
15 0.17
16 0.14
17 0.13
18 0.1
19 0.09
20 0.09
21 0.08
22 0.09
23 0.09
24 0.09
25 0.08
26 0.09
27 0.12
28 0.13
29 0.14
30 0.14
31 0.14
32 0.16
33 0.17
34 0.16
35 0.15
36 0.18
37 0.21
38 0.26
39 0.26
40 0.24
41 0.23
42 0.22
43 0.2
44 0.15
45 0.09
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.07
69 0.09
70 0.11
71 0.12
72 0.15
73 0.25
74 0.29
75 0.32
76 0.35
77 0.38
78 0.39
79 0.39
80 0.37
81 0.31
82 0.32
83 0.32
84 0.31
85 0.29
86 0.25
87 0.25
88 0.28
89 0.28
90 0.24
91 0.29
92 0.26
93 0.27
94 0.37
95 0.41
96 0.44
97 0.51
98 0.56
99 0.58
100 0.61
101 0.66