Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FZ50

Protein Details
Accession A0A0D2FZ50    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-185DLGMLKKFQDKKRQEQENGKKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, nucl 4, mito 4, mito_nucl 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023389  DOPA-like_sf  
IPR014980  DOPA_dioxygen  
Pfam View protein in Pfam  
PF08883  DOPA_dioxygen  
Amino Acid Sequences MSDPFLYSYPSPLKGYENLPPLPKDLNEDGKSFKNTVTGILSESYQRFTSGVTNGRRGGFDIHIYYHHNSEEQREFAKELWERVRREFPELRIYRLWDRPVGPHTMAMFEVNIFTPAQFGAFIPWLIINRGPLSALVHPNTDDGDELRAHSQRATWLGERVPLDLGMLKKFQDKKRQEQENGKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.34
4 0.36
5 0.35
6 0.38
7 0.37
8 0.36
9 0.35
10 0.32
11 0.32
12 0.31
13 0.37
14 0.36
15 0.37
16 0.38
17 0.4
18 0.43
19 0.37
20 0.32
21 0.26
22 0.24
23 0.25
24 0.24
25 0.19
26 0.18
27 0.17
28 0.17
29 0.17
30 0.17
31 0.17
32 0.15
33 0.14
34 0.13
35 0.13
36 0.16
37 0.17
38 0.24
39 0.25
40 0.28
41 0.3
42 0.31
43 0.3
44 0.28
45 0.27
46 0.21
47 0.2
48 0.17
49 0.16
50 0.17
51 0.2
52 0.2
53 0.18
54 0.17
55 0.16
56 0.15
57 0.19
58 0.21
59 0.19
60 0.19
61 0.19
62 0.19
63 0.18
64 0.24
65 0.19
66 0.2
67 0.27
68 0.32
69 0.32
70 0.35
71 0.41
72 0.36
73 0.42
74 0.41
75 0.36
76 0.4
77 0.39
78 0.4
79 0.34
80 0.36
81 0.34
82 0.34
83 0.33
84 0.25
85 0.25
86 0.24
87 0.25
88 0.25
89 0.21
90 0.2
91 0.19
92 0.17
93 0.16
94 0.14
95 0.12
96 0.08
97 0.08
98 0.06
99 0.07
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.09
120 0.12
121 0.15
122 0.18
123 0.18
124 0.18
125 0.18
126 0.19
127 0.19
128 0.16
129 0.13
130 0.09
131 0.11
132 0.1
133 0.11
134 0.14
135 0.15
136 0.15
137 0.15
138 0.16
139 0.17
140 0.2
141 0.24
142 0.22
143 0.24
144 0.25
145 0.29
146 0.28
147 0.26
148 0.24
149 0.19
150 0.18
151 0.18
152 0.19
153 0.17
154 0.18
155 0.18
156 0.24
157 0.33
158 0.4
159 0.47
160 0.53
161 0.61
162 0.71
163 0.8
164 0.81
165 0.84