Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2JE46

Protein Details
Accession A0A0D2JE46   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
482-504TVSKDKDRPSQEWKDHKPRSFSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020556  Amidase_CS  
IPR023631  Amidase_dom  
IPR036928  AS_sf  
Gene Ontology GO:0004040  F:amidase activity  
GO:0043864  F:indoleacetamide hydrolase activity  
Pfam View protein in Pfam  
PF01425  Amidase  
PROSITE View protein in PROSITE  
PS00571  AMIDASES  
Amino Acid Sequences MAASLPAWKVAARQRRQRQLSLIPQEWRLKTIPSAAEAKCTLPIVESCGILSPLELEITSPSNSAPYIISKIHTSAWSAYDVTLAFCKRAAVVQQLTSCLTEIFFDKALAQAKVLDEIFQKTGKPVGPLHGLPISLKDSQAVQGVDATNGWLARVGNPAAKDHPSVAAYRKLGAVLYVKTNIPQSTMMSDSYNHLFGQSVNSLNRHLISGGSSGGEGALIGSGGSVLGIGTDVGGSIRVPATLQGLYGLCPTIGRIGNRESARWQANIIPPVAGPMARDLDSIEYFLKSYLSSQPWKSDPVVVPIPWRENLVDEITSGSEKLKIGYIVDDGAVLPQPPVQRAVLETIEKLKAGGHQVVPWDASSHAKGSDMWVKAILSEGGRDAAEMSKLGNGEPLIPGMLTGTAETYLDADQRQSLGDEIFEYQDEYLARWEASNLDALIMPVTQWVGLRPKAWVQADMYIGYTAIFNLLNWTAFTVPATTVSKDKDRPSQEWKDHKPRSFSDRFNHDYYDVDLFDGMPVGVQIVTGRFGEEKAIGVAKVLRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.72
3 0.79
4 0.79
5 0.78
6 0.78
7 0.79
8 0.78
9 0.74
10 0.67
11 0.68
12 0.7
13 0.62
14 0.56
15 0.47
16 0.4
17 0.36
18 0.4
19 0.35
20 0.31
21 0.37
22 0.34
23 0.38
24 0.36
25 0.35
26 0.3
27 0.28
28 0.24
29 0.19
30 0.19
31 0.2
32 0.2
33 0.19
34 0.17
35 0.18
36 0.18
37 0.16
38 0.15
39 0.1
40 0.09
41 0.09
42 0.09
43 0.08
44 0.09
45 0.12
46 0.13
47 0.11
48 0.11
49 0.12
50 0.12
51 0.13
52 0.12
53 0.13
54 0.16
55 0.17
56 0.19
57 0.19
58 0.21
59 0.23
60 0.22
61 0.22
62 0.2
63 0.21
64 0.21
65 0.2
66 0.18
67 0.18
68 0.17
69 0.15
70 0.17
71 0.16
72 0.14
73 0.14
74 0.15
75 0.13
76 0.16
77 0.18
78 0.21
79 0.23
80 0.28
81 0.29
82 0.31
83 0.31
84 0.29
85 0.26
86 0.19
87 0.15
88 0.11
89 0.11
90 0.12
91 0.11
92 0.11
93 0.11
94 0.15
95 0.18
96 0.17
97 0.16
98 0.16
99 0.15
100 0.19
101 0.18
102 0.17
103 0.15
104 0.17
105 0.19
106 0.18
107 0.18
108 0.15
109 0.2
110 0.19
111 0.21
112 0.2
113 0.22
114 0.27
115 0.26
116 0.29
117 0.26
118 0.25
119 0.22
120 0.23
121 0.22
122 0.17
123 0.17
124 0.15
125 0.14
126 0.15
127 0.19
128 0.16
129 0.13
130 0.15
131 0.15
132 0.15
133 0.14
134 0.12
135 0.09
136 0.09
137 0.09
138 0.08
139 0.07
140 0.09
141 0.12
142 0.13
143 0.14
144 0.15
145 0.17
146 0.18
147 0.2
148 0.2
149 0.17
150 0.19
151 0.17
152 0.19
153 0.2
154 0.24
155 0.22
156 0.22
157 0.22
158 0.19
159 0.18
160 0.18
161 0.17
162 0.13
163 0.15
164 0.16
165 0.15
166 0.16
167 0.19
168 0.17
169 0.16
170 0.16
171 0.14
172 0.15
173 0.16
174 0.16
175 0.14
176 0.15
177 0.15
178 0.16
179 0.16
180 0.13
181 0.11
182 0.11
183 0.1
184 0.13
185 0.13
186 0.14
187 0.15
188 0.16
189 0.16
190 0.17
191 0.17
192 0.13
193 0.12
194 0.09
195 0.09
196 0.09
197 0.08
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.04
204 0.03
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.05
228 0.07
229 0.06
230 0.06
231 0.07
232 0.07
233 0.08
234 0.08
235 0.07
236 0.05
237 0.05
238 0.06
239 0.08
240 0.11
241 0.1
242 0.12
243 0.15
244 0.21
245 0.22
246 0.22
247 0.2
248 0.23
249 0.24
250 0.22
251 0.21
252 0.19
253 0.22
254 0.24
255 0.22
256 0.17
257 0.15
258 0.16
259 0.15
260 0.1
261 0.07
262 0.07
263 0.08
264 0.08
265 0.08
266 0.08
267 0.09
268 0.09
269 0.1
270 0.09
271 0.08
272 0.08
273 0.08
274 0.08
275 0.06
276 0.08
277 0.12
278 0.15
279 0.18
280 0.19
281 0.23
282 0.24
283 0.26
284 0.25
285 0.26
286 0.23
287 0.24
288 0.26
289 0.23
290 0.24
291 0.24
292 0.25
293 0.2
294 0.2
295 0.15
296 0.14
297 0.15
298 0.15
299 0.13
300 0.11
301 0.11
302 0.1
303 0.1
304 0.09
305 0.07
306 0.08
307 0.07
308 0.08
309 0.08
310 0.08
311 0.09
312 0.09
313 0.1
314 0.08
315 0.08
316 0.07
317 0.06
318 0.06
319 0.06
320 0.05
321 0.05
322 0.07
323 0.08
324 0.08
325 0.1
326 0.1
327 0.1
328 0.11
329 0.15
330 0.15
331 0.15
332 0.15
333 0.16
334 0.16
335 0.16
336 0.15
337 0.12
338 0.12
339 0.15
340 0.17
341 0.15
342 0.16
343 0.17
344 0.18
345 0.18
346 0.15
347 0.13
348 0.11
349 0.12
350 0.12
351 0.12
352 0.11
353 0.11
354 0.11
355 0.14
356 0.2
357 0.19
358 0.18
359 0.18
360 0.18
361 0.17
362 0.18
363 0.16
364 0.09
365 0.09
366 0.09
367 0.09
368 0.09
369 0.08
370 0.08
371 0.08
372 0.08
373 0.08
374 0.08
375 0.08
376 0.09
377 0.09
378 0.1
379 0.09
380 0.1
381 0.1
382 0.1
383 0.08
384 0.08
385 0.08
386 0.06
387 0.06
388 0.05
389 0.05
390 0.05
391 0.05
392 0.05
393 0.06
394 0.06
395 0.07
396 0.08
397 0.08
398 0.08
399 0.09
400 0.09
401 0.09
402 0.09
403 0.09
404 0.08
405 0.08
406 0.09
407 0.09
408 0.1
409 0.1
410 0.1
411 0.08
412 0.11
413 0.1
414 0.1
415 0.11
416 0.11
417 0.11
418 0.1
419 0.11
420 0.1
421 0.1
422 0.12
423 0.1
424 0.1
425 0.1
426 0.1
427 0.1
428 0.09
429 0.08
430 0.06
431 0.06
432 0.06
433 0.06
434 0.09
435 0.14
436 0.16
437 0.17
438 0.19
439 0.23
440 0.3
441 0.31
442 0.3
443 0.27
444 0.29
445 0.31
446 0.29
447 0.26
448 0.19
449 0.17
450 0.15
451 0.12
452 0.08
453 0.08
454 0.07
455 0.06
456 0.09
457 0.1
458 0.1
459 0.1
460 0.12
461 0.11
462 0.11
463 0.12
464 0.1
465 0.1
466 0.14
467 0.17
468 0.17
469 0.2
470 0.24
471 0.31
472 0.35
473 0.4
474 0.44
475 0.48
476 0.53
477 0.59
478 0.65
479 0.68
480 0.73
481 0.78
482 0.8
483 0.83
484 0.83
485 0.81
486 0.76
487 0.76
488 0.75
489 0.72
490 0.7
491 0.7
492 0.69
493 0.65
494 0.63
495 0.54
496 0.47
497 0.42
498 0.38
499 0.29
500 0.23
501 0.2
502 0.17
503 0.16
504 0.15
505 0.11
506 0.06
507 0.06
508 0.06
509 0.06
510 0.05
511 0.06
512 0.07
513 0.09
514 0.09
515 0.11
516 0.11
517 0.11
518 0.14
519 0.14
520 0.14
521 0.15
522 0.17
523 0.15
524 0.16
525 0.2