Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2ICB5

Protein Details
Accession A0A0D2ICB5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
166-189GYLRKVRLSREKERAKREKKEFIGBasic
215-236VNGGMRRRVREKWEKKHEKVETBasic
NLS Segment(s)
PositionSequence
170-185KVRLSREKERAKREKK
220-231RRRVREKWEKKH
Subcellular Location(s) plas 17, mito 2, cyto 2, extr 2, E.R. 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MVLLTTTPCILAAISSLSYSERSSLDGLPTASGAPIEHKTVIALSHLAKGFTLNTLLRGTCVHVFPPPPKPQPSPEYVALMERLRKEQEQREYAALVSKRALEQGPDEEKDDISPSLVFNILLSIVMCAGAMFYLTRWWPNDGSRVLVSLSTGLVVGIAEATVYAGYLRKVRLSREKERAKREKKEFIGEYRGEPVDDTLLSTSTENEKIWGRGVNGGMRRRVREKWEKKHEKVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.11
6 0.12
7 0.13
8 0.11
9 0.13
10 0.15
11 0.16
12 0.17
13 0.19
14 0.19
15 0.17
16 0.17
17 0.15
18 0.13
19 0.11
20 0.09
21 0.1
22 0.12
23 0.14
24 0.14
25 0.14
26 0.14
27 0.14
28 0.15
29 0.12
30 0.12
31 0.11
32 0.16
33 0.17
34 0.16
35 0.16
36 0.16
37 0.15
38 0.14
39 0.16
40 0.11
41 0.13
42 0.14
43 0.14
44 0.14
45 0.14
46 0.16
47 0.15
48 0.16
49 0.15
50 0.16
51 0.19
52 0.22
53 0.31
54 0.35
55 0.38
56 0.43
57 0.45
58 0.49
59 0.5
60 0.51
61 0.48
62 0.42
63 0.4
64 0.35
65 0.32
66 0.29
67 0.26
68 0.24
69 0.2
70 0.2
71 0.2
72 0.22
73 0.26
74 0.31
75 0.37
76 0.37
77 0.38
78 0.37
79 0.35
80 0.33
81 0.33
82 0.26
83 0.18
84 0.16
85 0.14
86 0.13
87 0.14
88 0.14
89 0.09
90 0.1
91 0.15
92 0.18
93 0.18
94 0.19
95 0.18
96 0.18
97 0.17
98 0.17
99 0.11
100 0.08
101 0.08
102 0.06
103 0.06
104 0.07
105 0.06
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.04
122 0.05
123 0.07
124 0.08
125 0.11
126 0.12
127 0.14
128 0.19
129 0.18
130 0.21
131 0.19
132 0.19
133 0.17
134 0.15
135 0.14
136 0.09
137 0.08
138 0.05
139 0.05
140 0.04
141 0.04
142 0.03
143 0.03
144 0.03
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.03
152 0.04
153 0.05
154 0.08
155 0.09
156 0.14
157 0.16
158 0.22
159 0.32
160 0.39
161 0.47
162 0.56
163 0.66
164 0.69
165 0.78
166 0.83
167 0.83
168 0.85
169 0.84
170 0.84
171 0.78
172 0.79
173 0.73
174 0.69
175 0.68
176 0.59
177 0.52
178 0.47
179 0.43
180 0.33
181 0.29
182 0.23
183 0.17
184 0.15
185 0.14
186 0.1
187 0.1
188 0.11
189 0.11
190 0.12
191 0.14
192 0.16
193 0.15
194 0.17
195 0.19
196 0.2
197 0.22
198 0.23
199 0.21
200 0.24
201 0.26
202 0.31
203 0.35
204 0.4
205 0.45
206 0.47
207 0.52
208 0.53
209 0.56
210 0.59
211 0.64
212 0.69
213 0.72
214 0.78
215 0.83
216 0.85