Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2GMY8

Protein Details
Accession A0A0D2GMY8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
189-218EQKAHEKKENAKTARRKKDRMDELWKKYNGBasic
NLS Segment(s)
PositionSequence
191-208KAHEKKENAKTARRKKDR
Subcellular Location(s) nucl 9, mito 6.5, extr 6, cyto_mito 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGFVLSCFAPCFGSRSGATQTQPPECVEARSADRVQNLPGANYTLQPYLPMSSNGEYSIFLQADGFGNKKVLVEAYLDTRLKKSIISENKARETNADPIPLPEPVSLEDDQGRWYTCSSQIIVRWYLPGKNTRTFEETFYVFAAHGDVDVAVRLRGDIEPLGQPAAVHDDAQPLFTLANATPTEREKQEQKAHEKKENAKTARRKKDRMDELWKKYNGNRGGGAAGNGGQRTNNVSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.28
4 0.31
5 0.32
6 0.33
7 0.37
8 0.36
9 0.38
10 0.34
11 0.34
12 0.3
13 0.31
14 0.27
15 0.26
16 0.26
17 0.3
18 0.32
19 0.3
20 0.33
21 0.31
22 0.31
23 0.32
24 0.29
25 0.24
26 0.22
27 0.23
28 0.2
29 0.2
30 0.21
31 0.16
32 0.15
33 0.15
34 0.15
35 0.14
36 0.15
37 0.15
38 0.16
39 0.16
40 0.17
41 0.17
42 0.16
43 0.15
44 0.15
45 0.17
46 0.13
47 0.12
48 0.11
49 0.11
50 0.13
51 0.13
52 0.13
53 0.1
54 0.1
55 0.11
56 0.11
57 0.1
58 0.09
59 0.08
60 0.09
61 0.1
62 0.12
63 0.17
64 0.18
65 0.18
66 0.19
67 0.19
68 0.17
69 0.17
70 0.17
71 0.21
72 0.28
73 0.33
74 0.39
75 0.43
76 0.48
77 0.48
78 0.45
79 0.39
80 0.34
81 0.35
82 0.3
83 0.26
84 0.21
85 0.22
86 0.23
87 0.21
88 0.18
89 0.12
90 0.11
91 0.11
92 0.14
93 0.13
94 0.13
95 0.13
96 0.12
97 0.13
98 0.13
99 0.12
100 0.09
101 0.09
102 0.09
103 0.1
104 0.11
105 0.11
106 0.12
107 0.14
108 0.16
109 0.17
110 0.16
111 0.16
112 0.16
113 0.16
114 0.17
115 0.21
116 0.23
117 0.27
118 0.29
119 0.3
120 0.33
121 0.33
122 0.32
123 0.29
124 0.25
125 0.2
126 0.19
127 0.16
128 0.12
129 0.11
130 0.09
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.06
145 0.08
146 0.09
147 0.1
148 0.1
149 0.09
150 0.09
151 0.08
152 0.13
153 0.12
154 0.11
155 0.11
156 0.15
157 0.15
158 0.16
159 0.15
160 0.1
161 0.1
162 0.09
163 0.11
164 0.06
165 0.11
166 0.11
167 0.12
168 0.14
169 0.17
170 0.21
171 0.21
172 0.25
173 0.25
174 0.34
175 0.41
176 0.48
177 0.56
178 0.61
179 0.66
180 0.7
181 0.73
182 0.74
183 0.75
184 0.77
185 0.73
186 0.73
187 0.77
188 0.8
189 0.83
190 0.84
191 0.81
192 0.8
193 0.85
194 0.85
195 0.84
196 0.84
197 0.83
198 0.83
199 0.85
200 0.78
201 0.71
202 0.66
203 0.65
204 0.6
205 0.53
206 0.46
207 0.39
208 0.39
209 0.36
210 0.33
211 0.24
212 0.21
213 0.2
214 0.19
215 0.17
216 0.14
217 0.15
218 0.21