Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2J3E4

Protein Details
Accession A0A0D2J3E4   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-46KSQTPKVEPQEKKKTPKGRAKKRITYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 14.5, mito_nucl 10, cyto 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRITYTRRFVNVTMTGGKRKVRTEQLPSISFKNLDTNLTIHVDEPQPDIIKPSFDVAAAVVAVSWPIEMFSGRFLRMEAEKWWKTSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.49
4 0.5
5 0.53
6 0.62
7 0.65
8 0.7
9 0.7
10 0.72
11 0.75
12 0.76
13 0.8
14 0.79
15 0.8
16 0.8
17 0.83
18 0.84
19 0.84
20 0.87
21 0.89
22 0.89
23 0.89
24 0.9
25 0.87
26 0.85
27 0.81
28 0.79
29 0.74
30 0.66
31 0.57
32 0.52
33 0.46
34 0.39
35 0.36
36 0.29
37 0.27
38 0.28
39 0.3
40 0.26
41 0.26
42 0.29
43 0.31
44 0.35
45 0.39
46 0.43
47 0.46
48 0.45
49 0.45
50 0.42
51 0.35
52 0.31
53 0.24
54 0.21
55 0.17
56 0.15
57 0.14
58 0.13
59 0.14
60 0.15
61 0.15
62 0.11
63 0.13
64 0.13
65 0.13
66 0.14
67 0.14
68 0.13
69 0.13
70 0.16
71 0.14
72 0.14
73 0.14
74 0.14
75 0.12
76 0.11
77 0.12
78 0.08
79 0.09
80 0.07
81 0.07
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.04
90 0.05
91 0.05
92 0.11
93 0.13
94 0.14
95 0.14
96 0.15
97 0.18
98 0.2
99 0.22
100 0.23
101 0.31
102 0.33