Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2HEE8

Protein Details
Accession A0A0D2HEE8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
426-451LEKHLQNVQAKKKRRPIRNWLVARYYHydrophilic
NLS Segment(s)
PositionSequence
436-440KKKRR
Subcellular Location(s) plas 20, E.R. 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001296  Glyco_trans_1  
IPR028098  Glyco_trans_4-like_N  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF13579  Glyco_trans_4_4  
PF00534  Glycos_transf_1  
CDD cd03814  GT4-like  
Amino Acid Sequences MAVETIPRQPAPPPAPSDPKPIEPAQPNQDEFPSILKGRRVLLATESLGPVNGVSRTTLSLIEYLRRNGVQLAVVAPHSKESRLRPSGNGLSELRLPGYPLPYNPDLTVVYPFQLDDVYKRTFSPDVVYLASPASTGFQMLLQIRQLQEPPVVLLNFQTDLSAYSEILFPGPVARFSVWLLAVVQGFLFSHRTVHTIFYPSSGIRRYLEKAGAPSSRMVQLGRGVDTTLFDPSRRDHAYREELAPNGEIILVCVCRLAPEKGFEFLAQVAIKLLEEAFPFKLLVVGGNLNPAVEDEVRQLFDPVKDNVVFTGFLTGVNLARAYASGDVFLHCSITETFGLVVLEAMASGLPVIARDQGGPSDIVQDQQTGYLVPPHDLDLFASLVKRLSVNAVLRSDMAAAARKFTCETTWEKINRRVAWQIAEGLEKHLQNVQAKKKRRPIRNWLVARYYGFKAGIISPMVVRFRLHLAIMLVYLVWMMAAVVLILYGNKVFSRGWHLLSNLPLVLQEFHYRTFKQGLRDAVQRMVANQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.55
4 0.62
5 0.57
6 0.57
7 0.56
8 0.52
9 0.53
10 0.5
11 0.56
12 0.55
13 0.57
14 0.54
15 0.51
16 0.5
17 0.43
18 0.37
19 0.33
20 0.29
21 0.25
22 0.28
23 0.29
24 0.3
25 0.3
26 0.34
27 0.32
28 0.28
29 0.29
30 0.3
31 0.28
32 0.28
33 0.27
34 0.22
35 0.21
36 0.19
37 0.15
38 0.13
39 0.12
40 0.09
41 0.1
42 0.11
43 0.12
44 0.14
45 0.15
46 0.13
47 0.16
48 0.17
49 0.22
50 0.24
51 0.25
52 0.27
53 0.26
54 0.26
55 0.24
56 0.24
57 0.2
58 0.17
59 0.16
60 0.14
61 0.15
62 0.16
63 0.15
64 0.17
65 0.17
66 0.18
67 0.22
68 0.27
69 0.37
70 0.43
71 0.46
72 0.44
73 0.51
74 0.56
75 0.52
76 0.5
77 0.41
78 0.36
79 0.36
80 0.34
81 0.27
82 0.2
83 0.19
84 0.17
85 0.2
86 0.2
87 0.18
88 0.24
89 0.25
90 0.27
91 0.25
92 0.25
93 0.22
94 0.21
95 0.23
96 0.17
97 0.16
98 0.14
99 0.14
100 0.11
101 0.12
102 0.11
103 0.1
104 0.15
105 0.17
106 0.17
107 0.18
108 0.21
109 0.2
110 0.21
111 0.22
112 0.2
113 0.2
114 0.21
115 0.21
116 0.18
117 0.18
118 0.17
119 0.13
120 0.1
121 0.08
122 0.06
123 0.06
124 0.06
125 0.06
126 0.1
127 0.1
128 0.12
129 0.12
130 0.15
131 0.15
132 0.17
133 0.17
134 0.15
135 0.16
136 0.15
137 0.15
138 0.15
139 0.15
140 0.13
141 0.13
142 0.13
143 0.12
144 0.12
145 0.11
146 0.07
147 0.09
148 0.11
149 0.11
150 0.09
151 0.09
152 0.1
153 0.1
154 0.1
155 0.08
156 0.06
157 0.08
158 0.09
159 0.09
160 0.1
161 0.1
162 0.11
163 0.11
164 0.14
165 0.11
166 0.11
167 0.11
168 0.1
169 0.1
170 0.09
171 0.08
172 0.06
173 0.06
174 0.06
175 0.08
176 0.06
177 0.08
178 0.08
179 0.1
180 0.11
181 0.13
182 0.14
183 0.16
184 0.16
185 0.16
186 0.17
187 0.16
188 0.18
189 0.18
190 0.18
191 0.16
192 0.19
193 0.2
194 0.22
195 0.24
196 0.22
197 0.22
198 0.25
199 0.25
200 0.23
201 0.21
202 0.19
203 0.19
204 0.18
205 0.16
206 0.13
207 0.15
208 0.16
209 0.16
210 0.14
211 0.12
212 0.12
213 0.12
214 0.12
215 0.11
216 0.1
217 0.09
218 0.1
219 0.11
220 0.18
221 0.2
222 0.21
223 0.2
224 0.26
225 0.32
226 0.33
227 0.35
228 0.3
229 0.28
230 0.28
231 0.25
232 0.19
233 0.13
234 0.11
235 0.07
236 0.05
237 0.06
238 0.05
239 0.05
240 0.05
241 0.04
242 0.05
243 0.08
244 0.09
245 0.09
246 0.12
247 0.13
248 0.14
249 0.15
250 0.14
251 0.12
252 0.11
253 0.12
254 0.09
255 0.08
256 0.07
257 0.07
258 0.07
259 0.06
260 0.06
261 0.05
262 0.05
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.08
269 0.06
270 0.07
271 0.06
272 0.07
273 0.07
274 0.08
275 0.08
276 0.07
277 0.07
278 0.06
279 0.07
280 0.06
281 0.06
282 0.07
283 0.09
284 0.09
285 0.09
286 0.1
287 0.1
288 0.12
289 0.14
290 0.13
291 0.15
292 0.15
293 0.15
294 0.14
295 0.14
296 0.13
297 0.1
298 0.11
299 0.08
300 0.07
301 0.08
302 0.08
303 0.07
304 0.07
305 0.07
306 0.05
307 0.05
308 0.05
309 0.06
310 0.06
311 0.06
312 0.06
313 0.07
314 0.07
315 0.08
316 0.08
317 0.07
318 0.06
319 0.08
320 0.07
321 0.1
322 0.09
323 0.09
324 0.09
325 0.09
326 0.09
327 0.07
328 0.07
329 0.04
330 0.04
331 0.03
332 0.03
333 0.02
334 0.02
335 0.02
336 0.02
337 0.02
338 0.03
339 0.03
340 0.05
341 0.05
342 0.06
343 0.07
344 0.07
345 0.08
346 0.09
347 0.08
348 0.11
349 0.11
350 0.11
351 0.11
352 0.12
353 0.11
354 0.11
355 0.11
356 0.07
357 0.08
358 0.1
359 0.1
360 0.1
361 0.11
362 0.12
363 0.13
364 0.12
365 0.12
366 0.1
367 0.1
368 0.1
369 0.1
370 0.09
371 0.09
372 0.09
373 0.09
374 0.07
375 0.09
376 0.14
377 0.17
378 0.21
379 0.22
380 0.22
381 0.22
382 0.22
383 0.2
384 0.15
385 0.13
386 0.15
387 0.14
388 0.18
389 0.18
390 0.18
391 0.19
392 0.19
393 0.19
394 0.17
395 0.22
396 0.23
397 0.32
398 0.38
399 0.43
400 0.5
401 0.57
402 0.55
403 0.54
404 0.54
405 0.49
406 0.46
407 0.41
408 0.37
409 0.3
410 0.3
411 0.26
412 0.24
413 0.26
414 0.22
415 0.21
416 0.21
417 0.24
418 0.28
419 0.36
420 0.43
421 0.48
422 0.56
423 0.65
424 0.72
425 0.77
426 0.81
427 0.83
428 0.83
429 0.85
430 0.88
431 0.86
432 0.83
433 0.79
434 0.72
435 0.65
436 0.59
437 0.49
438 0.42
439 0.34
440 0.27
441 0.24
442 0.22
443 0.22
444 0.18
445 0.17
446 0.15
447 0.19
448 0.21
449 0.19
450 0.18
451 0.17
452 0.19
453 0.2
454 0.19
455 0.17
456 0.17
457 0.17
458 0.16
459 0.15
460 0.11
461 0.09
462 0.08
463 0.05
464 0.04
465 0.03
466 0.03
467 0.02
468 0.03
469 0.02
470 0.02
471 0.03
472 0.03
473 0.03
474 0.04
475 0.04
476 0.05
477 0.06
478 0.08
479 0.08
480 0.11
481 0.19
482 0.22
483 0.25
484 0.28
485 0.3
486 0.33
487 0.35
488 0.36
489 0.27
490 0.24
491 0.21
492 0.19
493 0.19
494 0.17
495 0.21
496 0.21
497 0.25
498 0.3
499 0.3
500 0.32
501 0.39
502 0.4
503 0.41
504 0.45
505 0.49
506 0.49
507 0.55
508 0.54
509 0.5
510 0.51