Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YP44

Protein Details
Accession A0A0D1YP44   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
378-398GKIEESKSPATRRRIRKRSDSBasic
NLS Segment(s)
PositionSequence
367-396KMRDRAKKRVSGKIEESKSPATRRRIRKRS
Subcellular Location(s) plas 18, mito 4, E.R. 2, vacu 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006694  Fatty_acid_hydroxylase  
Gene Ontology GO:0016020  C:membrane  
GO:0005506  F:iron ion binding  
GO:0016491  F:oxidoreductase activity  
GO:0044255  P:cellular lipid metabolic process  
GO:0016126  P:sterol biosynthetic process  
Pfam View protein in Pfam  
PF04116  FA_hydroxylase  
Amino Acid Sequences MVVASMSSFNPACYLPQTWSSYLPNALACPPPPSYVSTIYNYATAPFSSTFGTASTIISGLTNLPMLSFLLIPTFSSYSTSLNLLFFYLTWSTLVLSHPPLRVEIVATLAVRVLFYILPSAFFLFFDAVLPSAAENFKTLGDSALPFKNASRQNTIRMLRVLAWSVLNVLLGIVIQALVEILFTRLLVIRSALRVTTTLPMPFGILKDLVRGYLLRELIAYVFHRYTLHESNNALSRAHQEWYHALPTPFPLAGSYDHPLAYLVRSFLPTYLPAVLFRFHLLTYVLYLALVSLEETFAYSGYSTVPTNFILGGIARRTDTHVLCNGKGNYGPWGLIDWVMGTSVGADVVDDVTMEAEKHQLPERVDKMRDRAKKRVSGKIEESKSPATRRRIRKRSDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.26
4 0.3
5 0.31
6 0.35
7 0.36
8 0.36
9 0.36
10 0.34
11 0.28
12 0.25
13 0.27
14 0.26
15 0.23
16 0.24
17 0.24
18 0.24
19 0.24
20 0.26
21 0.27
22 0.3
23 0.33
24 0.32
25 0.34
26 0.32
27 0.32
28 0.29
29 0.26
30 0.21
31 0.17
32 0.17
33 0.14
34 0.15
35 0.14
36 0.15
37 0.14
38 0.13
39 0.15
40 0.13
41 0.12
42 0.12
43 0.11
44 0.1
45 0.1
46 0.1
47 0.08
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.1
61 0.11
62 0.1
63 0.13
64 0.14
65 0.14
66 0.15
67 0.16
68 0.15
69 0.14
70 0.14
71 0.12
72 0.11
73 0.09
74 0.11
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.11
81 0.12
82 0.11
83 0.15
84 0.18
85 0.2
86 0.2
87 0.2
88 0.2
89 0.19
90 0.18
91 0.14
92 0.12
93 0.12
94 0.12
95 0.11
96 0.1
97 0.1
98 0.08
99 0.08
100 0.07
101 0.05
102 0.05
103 0.08
104 0.07
105 0.08
106 0.09
107 0.1
108 0.09
109 0.09
110 0.1
111 0.08
112 0.08
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.08
127 0.07
128 0.08
129 0.09
130 0.12
131 0.13
132 0.13
133 0.13
134 0.13
135 0.2
136 0.25
137 0.27
138 0.32
139 0.32
140 0.37
141 0.45
142 0.47
143 0.42
144 0.38
145 0.35
146 0.28
147 0.28
148 0.23
149 0.16
150 0.14
151 0.11
152 0.11
153 0.09
154 0.07
155 0.06
156 0.05
157 0.04
158 0.03
159 0.03
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.03
169 0.03
170 0.03
171 0.04
172 0.05
173 0.06
174 0.06
175 0.07
176 0.07
177 0.08
178 0.09
179 0.08
180 0.07
181 0.07
182 0.08
183 0.1
184 0.1
185 0.1
186 0.09
187 0.1
188 0.1
189 0.1
190 0.09
191 0.08
192 0.07
193 0.07
194 0.09
195 0.09
196 0.08
197 0.08
198 0.08
199 0.08
200 0.11
201 0.11
202 0.1
203 0.1
204 0.1
205 0.09
206 0.11
207 0.1
208 0.08
209 0.08
210 0.09
211 0.09
212 0.1
213 0.15
214 0.19
215 0.2
216 0.2
217 0.21
218 0.22
219 0.27
220 0.27
221 0.21
222 0.17
223 0.2
224 0.19
225 0.2
226 0.18
227 0.15
228 0.17
229 0.19
230 0.2
231 0.19
232 0.17
233 0.17
234 0.18
235 0.18
236 0.15
237 0.13
238 0.11
239 0.1
240 0.11
241 0.14
242 0.14
243 0.13
244 0.13
245 0.13
246 0.13
247 0.12
248 0.11
249 0.1
250 0.09
251 0.09
252 0.1
253 0.1
254 0.1
255 0.11
256 0.11
257 0.12
258 0.13
259 0.13
260 0.13
261 0.14
262 0.14
263 0.13
264 0.14
265 0.13
266 0.1
267 0.11
268 0.11
269 0.1
270 0.1
271 0.1
272 0.09
273 0.07
274 0.07
275 0.06
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.05
284 0.04
285 0.05
286 0.05
287 0.05
288 0.06
289 0.08
290 0.08
291 0.09
292 0.1
293 0.1
294 0.11
295 0.11
296 0.1
297 0.09
298 0.09
299 0.11
300 0.11
301 0.11
302 0.11
303 0.12
304 0.16
305 0.21
306 0.22
307 0.23
308 0.29
309 0.32
310 0.33
311 0.4
312 0.37
313 0.33
314 0.33
315 0.3
316 0.27
317 0.24
318 0.23
319 0.16
320 0.17
321 0.15
322 0.14
323 0.13
324 0.09
325 0.08
326 0.09
327 0.08
328 0.06
329 0.05
330 0.05
331 0.05
332 0.04
333 0.04
334 0.04
335 0.05
336 0.05
337 0.04
338 0.04
339 0.05
340 0.06
341 0.06
342 0.06
343 0.09
344 0.1
345 0.13
346 0.18
347 0.23
348 0.26
349 0.35
350 0.41
351 0.45
352 0.5
353 0.52
354 0.56
355 0.61
356 0.68
357 0.66
358 0.7
359 0.72
360 0.76
361 0.78
362 0.79
363 0.77
364 0.76
365 0.78
366 0.78
367 0.74
368 0.69
369 0.67
370 0.65
371 0.64
372 0.63
373 0.62
374 0.62
375 0.67
376 0.74
377 0.79
378 0.82