Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YZC6

Protein Details
Accession A0A0D1YZC6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-54TEQPNKVTSKRRAKARKDREGLHydrophilic
NLS Segment(s)
PositionSequence
42-50KRRAKARKD
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVEVQPTSRKPQINRVATHEKQEEAVLHEAPVTEQPNKVTSKRRAKARKDREGLQALLSKSTQSKPSRSLSLMDLMKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.65
4 0.6
5 0.64
6 0.55
7 0.45
8 0.38
9 0.36
10 0.29
11 0.23
12 0.23
13 0.16
14 0.14
15 0.14
16 0.13
17 0.12
18 0.14
19 0.12
20 0.11
21 0.12
22 0.13
23 0.16
24 0.19
25 0.22
26 0.27
27 0.34
28 0.44
29 0.49
30 0.59
31 0.65
32 0.73
33 0.81
34 0.83
35 0.84
36 0.78
37 0.77
38 0.75
39 0.7
40 0.61
41 0.53
42 0.48
43 0.37
44 0.34
45 0.29
46 0.23
47 0.21
48 0.23
49 0.28
50 0.27
51 0.32
52 0.36
53 0.42
54 0.46
55 0.45
56 0.44
57 0.39
58 0.43