Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1X473

Protein Details
Accession A0A0D1X473    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-107HVLCCRKKTCSKKVGSVRAFRHydrophilic
NLS Segment(s)
PositionSequence
109-120VRKGETREKKGK
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007320  PDCD2_C  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF04194  PDCD2_C  
Amino Acid Sequences MPPYESDSSSDDGEDYSTTNVTLGYASADSTGDDISHLGGYPTWLDAHQTPAAALSKCKVCNGYMSLLLQLNADLQQYFPHDERRLHVLCCRKKTCSKKVGSVRAFREVRKGETREKKGKQPEQVQTKKPTQDLGSALFGGPGSSPSMNSANPFSTSSTSTQSTINPFSSLGSPSELAAKSPQPPVDEIQPPTESFADKLRITSETESSGKDKQFSEAWPNDSQLPPPFTSFYLDAYPEELEKESATDSKAESSKIQYDTEESGSGAGLEKDTFESSLDKTFQKFSDRVAQNPEQVLRYEFKGEPLLYSGSDGVASRFIVPHGKSGAIRGMPRCENCGAQRVFEVQLVPGLIYELEKDEAMDLEDGMEWGTVIVGTCVNNCGVPGQVSFREEWVGVQWEERVAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.1
5 0.1
6 0.1
7 0.09
8 0.09
9 0.08
10 0.07
11 0.08
12 0.08
13 0.08
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.07
20 0.07
21 0.07
22 0.07
23 0.08
24 0.08
25 0.07
26 0.07
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.12
33 0.13
34 0.18
35 0.19
36 0.18
37 0.17
38 0.2
39 0.24
40 0.21
41 0.21
42 0.21
43 0.25
44 0.26
45 0.29
46 0.28
47 0.24
48 0.29
49 0.32
50 0.31
51 0.27
52 0.27
53 0.28
54 0.27
55 0.26
56 0.2
57 0.16
58 0.14
59 0.12
60 0.12
61 0.09
62 0.08
63 0.1
64 0.12
65 0.16
66 0.16
67 0.23
68 0.26
69 0.28
70 0.31
71 0.37
72 0.37
73 0.35
74 0.39
75 0.42
76 0.46
77 0.53
78 0.55
79 0.54
80 0.61
81 0.7
82 0.75
83 0.75
84 0.73
85 0.73
86 0.79
87 0.83
88 0.81
89 0.79
90 0.72
91 0.72
92 0.68
93 0.59
94 0.58
95 0.51
96 0.49
97 0.49
98 0.5
99 0.5
100 0.58
101 0.66
102 0.67
103 0.68
104 0.71
105 0.73
106 0.76
107 0.75
108 0.74
109 0.74
110 0.75
111 0.79
112 0.77
113 0.73
114 0.73
115 0.68
116 0.59
117 0.54
118 0.45
119 0.41
120 0.37
121 0.32
122 0.27
123 0.23
124 0.22
125 0.19
126 0.16
127 0.12
128 0.09
129 0.07
130 0.07
131 0.07
132 0.07
133 0.09
134 0.12
135 0.12
136 0.13
137 0.14
138 0.13
139 0.15
140 0.16
141 0.15
142 0.14
143 0.16
144 0.17
145 0.18
146 0.19
147 0.18
148 0.18
149 0.19
150 0.21
151 0.21
152 0.2
153 0.17
154 0.16
155 0.16
156 0.16
157 0.15
158 0.12
159 0.11
160 0.1
161 0.1
162 0.14
163 0.13
164 0.12
165 0.13
166 0.14
167 0.16
168 0.18
169 0.2
170 0.16
171 0.18
172 0.19
173 0.23
174 0.25
175 0.24
176 0.24
177 0.23
178 0.22
179 0.22
180 0.21
181 0.16
182 0.13
183 0.14
184 0.15
185 0.14
186 0.14
187 0.14
188 0.15
189 0.16
190 0.17
191 0.15
192 0.14
193 0.15
194 0.16
195 0.17
196 0.2
197 0.19
198 0.2
199 0.19
200 0.18
201 0.19
202 0.19
203 0.25
204 0.24
205 0.27
206 0.26
207 0.26
208 0.26
209 0.25
210 0.25
211 0.21
212 0.21
213 0.17
214 0.17
215 0.18
216 0.16
217 0.18
218 0.17
219 0.16
220 0.14
221 0.14
222 0.13
223 0.13
224 0.13
225 0.11
226 0.11
227 0.09
228 0.08
229 0.07
230 0.08
231 0.07
232 0.08
233 0.09
234 0.09
235 0.09
236 0.12
237 0.14
238 0.14
239 0.15
240 0.17
241 0.22
242 0.23
243 0.23
244 0.2
245 0.21
246 0.22
247 0.22
248 0.2
249 0.14
250 0.12
251 0.11
252 0.11
253 0.09
254 0.07
255 0.06
256 0.05
257 0.06
258 0.07
259 0.07
260 0.07
261 0.08
262 0.09
263 0.1
264 0.14
265 0.16
266 0.16
267 0.17
268 0.2
269 0.21
270 0.25
271 0.24
272 0.24
273 0.32
274 0.33
275 0.34
276 0.39
277 0.4
278 0.38
279 0.41
280 0.39
281 0.3
282 0.29
283 0.29
284 0.23
285 0.21
286 0.23
287 0.2
288 0.2
289 0.24
290 0.23
291 0.21
292 0.21
293 0.21
294 0.16
295 0.17
296 0.15
297 0.1
298 0.11
299 0.1
300 0.09
301 0.09
302 0.09
303 0.09
304 0.09
305 0.1
306 0.15
307 0.16
308 0.19
309 0.2
310 0.22
311 0.21
312 0.23
313 0.28
314 0.26
315 0.29
316 0.28
317 0.33
318 0.37
319 0.38
320 0.39
321 0.36
322 0.37
323 0.35
324 0.42
325 0.36
326 0.31
327 0.32
328 0.31
329 0.3
330 0.27
331 0.25
332 0.16
333 0.17
334 0.16
335 0.14
336 0.11
337 0.1
338 0.08
339 0.08
340 0.08
341 0.08
342 0.09
343 0.09
344 0.09
345 0.09
346 0.1
347 0.11
348 0.1
349 0.08
350 0.08
351 0.08
352 0.08
353 0.08
354 0.07
355 0.05
356 0.05
357 0.05
358 0.04
359 0.04
360 0.05
361 0.06
362 0.07
363 0.08
364 0.1
365 0.1
366 0.1
367 0.1
368 0.11
369 0.11
370 0.12
371 0.13
372 0.17
373 0.2
374 0.22
375 0.23
376 0.23
377 0.24
378 0.22
379 0.21
380 0.2
381 0.22
382 0.2
383 0.21
384 0.21
385 0.19