Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YA60

Protein Details
Accession A0A0D1YA60    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-110RDMCAEKEKEDKKRRERERQREREREREHREPVFBasic
NLS Segment(s)
PositionSequence
84-106EKEDKKRRERERQREREREREHR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences MAGSPRRRVVINNNVLQQHAHTHNDNDLKKAQQNLDAAKTTLSVLQERMVKLEGQMRELKGPMVKAEQDVHRARVARDMCAEKEKEDKKRRERERQREREREREHREPVFLLVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.47
4 0.38
5 0.34
6 0.29
7 0.27
8 0.24
9 0.25
10 0.31
11 0.39
12 0.38
13 0.35
14 0.34
15 0.34
16 0.35
17 0.38
18 0.33
19 0.3
20 0.33
21 0.33
22 0.34
23 0.32
24 0.29
25 0.24
26 0.23
27 0.18
28 0.16
29 0.14
30 0.11
31 0.1
32 0.13
33 0.16
34 0.15
35 0.16
36 0.15
37 0.14
38 0.14
39 0.18
40 0.16
41 0.16
42 0.18
43 0.17
44 0.17
45 0.18
46 0.18
47 0.13
48 0.13
49 0.11
50 0.11
51 0.11
52 0.12
53 0.15
54 0.16
55 0.22
56 0.23
57 0.24
58 0.24
59 0.25
60 0.24
61 0.28
62 0.27
63 0.22
64 0.25
65 0.27
66 0.26
67 0.31
68 0.31
69 0.26
70 0.34
71 0.39
72 0.45
73 0.52
74 0.6
75 0.64
76 0.74
77 0.82
78 0.85
79 0.89
80 0.9
81 0.92
82 0.93
83 0.94
84 0.94
85 0.92
86 0.91
87 0.89
88 0.89
89 0.87
90 0.84
91 0.81
92 0.75
93 0.7
94 0.6
95 0.57