Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1WY70

Protein Details
Accession A0A0D1WY70    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTHRKATGIRKPRKKPRLGKVFNCLVCHydrophilic
NLS Segment(s)
PositionSequence
5-19KATGIRKPRKKPRLG
38-51RRKKKMIGGKKRTV
Subcellular Location(s) mito 14, cyto 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MTHRKATGIRKPRKKPRLGKVFNCLVCERNDVVRVEMRRKKKMIGGKKRTVKEGTGKLECSSCHAKFQHPIGHLSAEVDVFSAWVDALDAKKEANDAAVATSTTTGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.91
5 0.9
6 0.87
7 0.84
8 0.83
9 0.75
10 0.68
11 0.59
12 0.49
13 0.42
14 0.38
15 0.32
16 0.25
17 0.27
18 0.23
19 0.24
20 0.27
21 0.28
22 0.33
23 0.39
24 0.43
25 0.46
26 0.47
27 0.47
28 0.48
29 0.54
30 0.56
31 0.6
32 0.63
33 0.65
34 0.72
35 0.71
36 0.69
37 0.62
38 0.54
39 0.5
40 0.47
41 0.44
42 0.38
43 0.37
44 0.33
45 0.32
46 0.29
47 0.27
48 0.26
49 0.21
50 0.25
51 0.25
52 0.27
53 0.3
54 0.35
55 0.36
56 0.31
57 0.33
58 0.29
59 0.29
60 0.26
61 0.22
62 0.18
63 0.12
64 0.1
65 0.08
66 0.06
67 0.05
68 0.05
69 0.04
70 0.04
71 0.03
72 0.04
73 0.05
74 0.06
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.08
84 0.1
85 0.11
86 0.1
87 0.1