Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1VP54

Protein Details
Accession A0A0D1VP54   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-29RDQRHDNVSNRNKNKNRLADKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005337  RapZ-like  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF03668  ATP_bind_2  
Amino Acid Sequences MFDSIDDERDQRHDNVSNRNKNKNRLADKALKAVNNFHEQAMDDIKDYHDTDDDDNNDNKNDKNGNNNYDTKDKSPTFKLSIISYGSTFGRLEESPGDEHMDFSIADIPNPSAKIRKAHTGLSSELREAVMAEDLAPEWLNDITNEVQSKIAKMKSAHKKDPLSPTKLVIGLACGLGKHRSVTFAEELPRKLKTDGWTVTVHHRDISLNAEQAGSDEEDGSSAISTQTFDRKGMEKKNKDMREETKRRISSEGNDATTVAGADGGLDREGNEISALAWEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.48
3 0.57
4 0.63
5 0.67
6 0.76
7 0.77
8 0.79
9 0.83
10 0.82
11 0.79
12 0.76
13 0.77
14 0.77
15 0.73
16 0.72
17 0.67
18 0.6
19 0.53
20 0.51
21 0.48
22 0.45
23 0.42
24 0.33
25 0.3
26 0.28
27 0.29
28 0.27
29 0.22
30 0.16
31 0.16
32 0.17
33 0.19
34 0.19
35 0.17
36 0.15
37 0.16
38 0.18
39 0.23
40 0.25
41 0.26
42 0.27
43 0.27
44 0.28
45 0.27
46 0.26
47 0.25
48 0.28
49 0.26
50 0.34
51 0.39
52 0.42
53 0.47
54 0.5
55 0.48
56 0.49
57 0.5
58 0.43
59 0.44
60 0.4
61 0.39
62 0.4
63 0.41
64 0.39
65 0.39
66 0.38
67 0.32
68 0.33
69 0.3
70 0.26
71 0.21
72 0.19
73 0.16
74 0.16
75 0.14
76 0.11
77 0.12
78 0.11
79 0.12
80 0.12
81 0.14
82 0.13
83 0.14
84 0.16
85 0.13
86 0.14
87 0.12
88 0.11
89 0.09
90 0.09
91 0.14
92 0.11
93 0.11
94 0.11
95 0.12
96 0.12
97 0.14
98 0.14
99 0.12
100 0.14
101 0.18
102 0.2
103 0.26
104 0.27
105 0.3
106 0.32
107 0.32
108 0.32
109 0.32
110 0.3
111 0.23
112 0.21
113 0.18
114 0.15
115 0.12
116 0.1
117 0.06
118 0.05
119 0.05
120 0.04
121 0.04
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.06
130 0.07
131 0.08
132 0.09
133 0.08
134 0.1
135 0.1
136 0.11
137 0.13
138 0.13
139 0.15
140 0.17
141 0.26
142 0.35
143 0.43
144 0.48
145 0.51
146 0.54
147 0.57
148 0.65
149 0.62
150 0.58
151 0.51
152 0.47
153 0.41
154 0.38
155 0.33
156 0.22
157 0.16
158 0.11
159 0.1
160 0.09
161 0.07
162 0.07
163 0.08
164 0.09
165 0.09
166 0.09
167 0.11
168 0.12
169 0.15
170 0.16
171 0.18
172 0.23
173 0.25
174 0.27
175 0.27
176 0.27
177 0.25
178 0.24
179 0.25
180 0.23
181 0.29
182 0.29
183 0.3
184 0.3
185 0.31
186 0.38
187 0.38
188 0.35
189 0.27
190 0.26
191 0.23
192 0.22
193 0.25
194 0.19
195 0.16
196 0.16
197 0.15
198 0.14
199 0.14
200 0.15
201 0.11
202 0.08
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.08
214 0.14
215 0.16
216 0.16
217 0.19
218 0.25
219 0.32
220 0.42
221 0.51
222 0.52
223 0.61
224 0.71
225 0.74
226 0.73
227 0.74
228 0.73
229 0.74
230 0.76
231 0.74
232 0.74
233 0.72
234 0.68
235 0.65
236 0.6
237 0.54
238 0.55
239 0.54
240 0.45
241 0.43
242 0.4
243 0.35
244 0.31
245 0.25
246 0.15
247 0.08
248 0.05
249 0.05
250 0.06
251 0.07
252 0.07
253 0.07
254 0.07
255 0.09
256 0.09
257 0.09
258 0.08
259 0.07
260 0.07