Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YDZ3

Protein Details
Accession A0A0D1YDZ3   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
351-374SLDSNHKKPVKRVKRDRVEWHEMLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038816  Stationary_phase_5  
Gene Ontology GO:0070628  F:proteasome binding  
Amino Acid Sequences MAASGGHLLVPKALKAFRWVFERTGRLIREKIPQAAKPTLEATAEPAYARIPQRQTVNRLDQIRQAQSRHYSTKQNINHTVRHYSSQPGPSARPSRASYPSSRTATAVSRKTGRTPFAATLRPNLTGGTLCRSAGGYGLGGGRVGGARYFSHSPAAPAHVVNNVSQAVRAFWLSGQKARFDGANPRTGEKRFRAISSLQEDARHTMDMSSTNAPGSFIDFKVAPTITAIGPLSTIPRSESASTCEDNSLNDAIIMSNLSADFARALKDLAAIMNDLKHLATLGDLPITLHNSTTLRVRFPGCDADTVENLCRELNIKRGIVGQDEDFDAQNGTDMALMFPYAPSRTASEVSLDSNHKKPVKRVKRDRVEWHEMLTPPQQGSPGFSHLSATSHSQDAFEMIDNAMGHNPWNSSPSGYSSLHESEVRADDDAAMYFFQPDQTRMAKQHAKPVRADGYEGLEGIYRFIEECDRARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.31
4 0.32
5 0.37
6 0.39
7 0.39
8 0.45
9 0.49
10 0.46
11 0.49
12 0.48
13 0.48
14 0.49
15 0.49
16 0.51
17 0.52
18 0.55
19 0.54
20 0.55
21 0.56
22 0.58
23 0.54
24 0.47
25 0.43
26 0.37
27 0.31
28 0.27
29 0.25
30 0.22
31 0.22
32 0.19
33 0.17
34 0.16
35 0.21
36 0.23
37 0.26
38 0.27
39 0.31
40 0.4
41 0.46
42 0.52
43 0.56
44 0.61
45 0.61
46 0.62
47 0.6
48 0.58
49 0.58
50 0.59
51 0.55
52 0.49
53 0.48
54 0.51
55 0.55
56 0.55
57 0.52
58 0.53
59 0.53
60 0.62
61 0.62
62 0.63
63 0.67
64 0.65
65 0.67
66 0.62
67 0.63
68 0.56
69 0.53
70 0.46
71 0.41
72 0.42
73 0.42
74 0.42
75 0.39
76 0.39
77 0.44
78 0.48
79 0.44
80 0.44
81 0.42
82 0.44
83 0.46
84 0.48
85 0.46
86 0.47
87 0.53
88 0.5
89 0.48
90 0.43
91 0.39
92 0.41
93 0.43
94 0.41
95 0.37
96 0.39
97 0.4
98 0.45
99 0.48
100 0.43
101 0.39
102 0.39
103 0.4
104 0.4
105 0.44
106 0.39
107 0.4
108 0.39
109 0.37
110 0.33
111 0.27
112 0.23
113 0.19
114 0.19
115 0.18
116 0.16
117 0.15
118 0.15
119 0.15
120 0.14
121 0.13
122 0.12
123 0.07
124 0.07
125 0.08
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.06
134 0.06
135 0.11
136 0.13
137 0.13
138 0.16
139 0.16
140 0.17
141 0.18
142 0.21
143 0.17
144 0.16
145 0.16
146 0.16
147 0.17
148 0.15
149 0.16
150 0.14
151 0.13
152 0.13
153 0.12
154 0.1
155 0.09
156 0.09
157 0.07
158 0.08
159 0.13
160 0.14
161 0.18
162 0.19
163 0.19
164 0.19
165 0.2
166 0.19
167 0.15
168 0.24
169 0.23
170 0.29
171 0.28
172 0.3
173 0.33
174 0.34
175 0.38
176 0.32
177 0.35
178 0.3
179 0.3
180 0.31
181 0.29
182 0.34
183 0.32
184 0.32
185 0.26
186 0.26
187 0.26
188 0.24
189 0.24
190 0.18
191 0.14
192 0.11
193 0.11
194 0.1
195 0.13
196 0.12
197 0.11
198 0.11
199 0.11
200 0.11
201 0.1
202 0.11
203 0.11
204 0.09
205 0.1
206 0.1
207 0.1
208 0.12
209 0.12
210 0.09
211 0.08
212 0.09
213 0.08
214 0.09
215 0.09
216 0.07
217 0.07
218 0.07
219 0.08
220 0.07
221 0.07
222 0.06
223 0.08
224 0.1
225 0.11
226 0.11
227 0.14
228 0.17
229 0.17
230 0.17
231 0.17
232 0.15
233 0.14
234 0.15
235 0.12
236 0.08
237 0.08
238 0.07
239 0.06
240 0.06
241 0.06
242 0.04
243 0.03
244 0.03
245 0.04
246 0.04
247 0.04
248 0.04
249 0.05
250 0.06
251 0.06
252 0.06
253 0.06
254 0.06
255 0.07
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.05
265 0.05
266 0.04
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.06
273 0.07
274 0.09
275 0.08
276 0.08
277 0.09
278 0.09
279 0.1
280 0.16
281 0.16
282 0.15
283 0.17
284 0.19
285 0.18
286 0.2
287 0.26
288 0.21
289 0.22
290 0.23
291 0.23
292 0.23
293 0.23
294 0.22
295 0.16
296 0.15
297 0.13
298 0.11
299 0.11
300 0.11
301 0.16
302 0.19
303 0.19
304 0.2
305 0.23
306 0.24
307 0.24
308 0.24
309 0.18
310 0.15
311 0.16
312 0.16
313 0.13
314 0.12
315 0.1
316 0.08
317 0.08
318 0.07
319 0.06
320 0.06
321 0.06
322 0.05
323 0.05
324 0.06
325 0.05
326 0.05
327 0.07
328 0.07
329 0.08
330 0.09
331 0.11
332 0.14
333 0.15
334 0.15
335 0.16
336 0.17
337 0.18
338 0.21
339 0.23
340 0.24
341 0.26
342 0.33
343 0.36
344 0.38
345 0.45
346 0.52
347 0.59
348 0.66
349 0.74
350 0.78
351 0.83
352 0.89
353 0.91
354 0.89
355 0.87
356 0.77
357 0.69
358 0.64
359 0.54
360 0.48
361 0.42
362 0.35
363 0.26
364 0.26
365 0.25
366 0.19
367 0.23
368 0.22
369 0.22
370 0.21
371 0.2
372 0.21
373 0.2
374 0.21
375 0.19
376 0.2
377 0.18
378 0.18
379 0.18
380 0.17
381 0.17
382 0.16
383 0.16
384 0.12
385 0.11
386 0.1
387 0.12
388 0.11
389 0.12
390 0.12
391 0.11
392 0.11
393 0.11
394 0.13
395 0.11
396 0.13
397 0.13
398 0.14
399 0.16
400 0.2
401 0.24
402 0.24
403 0.23
404 0.26
405 0.28
406 0.29
407 0.28
408 0.24
409 0.22
410 0.25
411 0.25
412 0.21
413 0.19
414 0.17
415 0.17
416 0.17
417 0.13
418 0.1
419 0.09
420 0.1
421 0.1
422 0.13
423 0.14
424 0.15
425 0.2
426 0.24
427 0.28
428 0.31
429 0.4
430 0.45
431 0.45
432 0.54
433 0.58
434 0.58
435 0.56
436 0.61
437 0.59
438 0.52
439 0.51
440 0.43
441 0.41
442 0.38
443 0.35
444 0.27
445 0.21
446 0.2
447 0.18
448 0.16
449 0.1
450 0.1
451 0.11
452 0.15
453 0.16