Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YA61

Protein Details
Accession A0A0D1YA61    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
20-42PDLPQRKSKGRDKSDTRRKLKHABasic
NLS Segment(s)
PositionSequence
25-39RKSKGRDKSDTRRKL
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
Amino Acid Sequences MMYEVRFQREPYALYRAMLPDLPQRKSKGRDKSDTRRKLKHAAEEDAFGDTSDPNYLRPRSYGFASVLGQAPRAQTMWQIKMGGQEKNAIIKTCECTIVDRPAEEHRTPVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.27
4 0.25
5 0.23
6 0.21
7 0.23
8 0.29
9 0.31
10 0.33
11 0.37
12 0.42
13 0.5
14 0.56
15 0.58
16 0.6
17 0.67
18 0.72
19 0.79
20 0.82
21 0.85
22 0.84
23 0.81
24 0.77
25 0.77
26 0.72
27 0.7
28 0.64
29 0.59
30 0.53
31 0.46
32 0.42
33 0.34
34 0.29
35 0.19
36 0.14
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.11
43 0.12
44 0.12
45 0.14
46 0.16
47 0.17
48 0.18
49 0.19
50 0.16
51 0.18
52 0.18
53 0.18
54 0.19
55 0.16
56 0.16
57 0.14
58 0.13
59 0.12
60 0.11
61 0.1
62 0.13
63 0.19
64 0.2
65 0.22
66 0.22
67 0.22
68 0.29
69 0.32
70 0.29
71 0.24
72 0.26
73 0.25
74 0.3
75 0.31
76 0.25
77 0.23
78 0.24
79 0.27
80 0.25
81 0.26
82 0.21
83 0.24
84 0.27
85 0.34
86 0.32
87 0.29
88 0.3
89 0.36
90 0.42
91 0.38
92 0.36