Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Y2T2

Protein Details
Accession A0A0D1Y2T2   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-26AGPQLPPELQKRKRSNEDDEDNSHydrophilic
NLS Segment(s)
PositionSequence
156-156K
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MSAAGPQLPPELQKRKRSNEDDEDNSSDSSTGRLPPQPHTQGRSPPSPKRTRVIGPSLPPAPLDERPSDPPRPDIDQDEGESSDDDDDFGPSLPSATDAAKTSSNGLQAPPDSTRAPAPAQRDEWMTLAPTSGDWSTRVDPTKLKNRKFNTGRGSKAPPKPPSGGDQSWHETPEEKQARLKREVMGIKDSATTTGPKHEANAHDEETARRLKEYNEKQRGTSLYASHNASSKPIEEDDPSARAFDREKDIAGGMTINATKRREMLKKASDFSSRFGESRYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.77
4 0.81
5 0.81
6 0.81
7 0.81
8 0.77
9 0.74
10 0.68
11 0.59
12 0.52
13 0.43
14 0.33
15 0.24
16 0.2
17 0.16
18 0.15
19 0.17
20 0.22
21 0.24
22 0.3
23 0.4
24 0.47
25 0.51
26 0.53
27 0.55
28 0.59
29 0.61
30 0.66
31 0.64
32 0.64
33 0.68
34 0.72
35 0.7
36 0.67
37 0.68
38 0.64
39 0.64
40 0.64
41 0.6
42 0.55
43 0.57
44 0.53
45 0.47
46 0.4
47 0.35
48 0.31
49 0.28
50 0.27
51 0.24
52 0.26
53 0.33
54 0.38
55 0.41
56 0.38
57 0.38
58 0.38
59 0.41
60 0.39
61 0.36
62 0.35
63 0.33
64 0.33
65 0.3
66 0.27
67 0.22
68 0.19
69 0.16
70 0.12
71 0.1
72 0.09
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.09
86 0.11
87 0.12
88 0.13
89 0.14
90 0.14
91 0.16
92 0.15
93 0.14
94 0.14
95 0.13
96 0.15
97 0.14
98 0.15
99 0.14
100 0.14
101 0.15
102 0.15
103 0.16
104 0.17
105 0.2
106 0.22
107 0.23
108 0.23
109 0.24
110 0.23
111 0.22
112 0.19
113 0.15
114 0.11
115 0.1
116 0.09
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.09
123 0.11
124 0.14
125 0.16
126 0.15
127 0.18
128 0.23
129 0.33
130 0.38
131 0.42
132 0.47
133 0.49
134 0.58
135 0.59
136 0.61
137 0.6
138 0.58
139 0.57
140 0.54
141 0.57
142 0.55
143 0.59
144 0.59
145 0.54
146 0.51
147 0.5
148 0.47
149 0.44
150 0.44
151 0.38
152 0.32
153 0.32
154 0.32
155 0.31
156 0.3
157 0.25
158 0.19
159 0.19
160 0.27
161 0.27
162 0.24
163 0.29
164 0.33
165 0.39
166 0.42
167 0.43
168 0.35
169 0.38
170 0.42
171 0.39
172 0.37
173 0.32
174 0.28
175 0.27
176 0.25
177 0.19
178 0.16
179 0.15
180 0.12
181 0.16
182 0.17
183 0.16
184 0.18
185 0.22
186 0.23
187 0.26
188 0.3
189 0.27
190 0.26
191 0.27
192 0.26
193 0.25
194 0.26
195 0.22
196 0.18
197 0.18
198 0.2
199 0.3
200 0.4
201 0.47
202 0.53
203 0.55
204 0.55
205 0.59
206 0.58
207 0.51
208 0.45
209 0.37
210 0.32
211 0.35
212 0.36
213 0.32
214 0.33
215 0.29
216 0.27
217 0.25
218 0.21
219 0.2
220 0.19
221 0.2
222 0.19
223 0.23
224 0.24
225 0.25
226 0.24
227 0.22
228 0.21
229 0.2
230 0.2
231 0.2
232 0.24
233 0.23
234 0.24
235 0.25
236 0.25
237 0.23
238 0.22
239 0.18
240 0.11
241 0.12
242 0.13
243 0.15
244 0.19
245 0.21
246 0.21
247 0.25
248 0.34
249 0.38
250 0.44
251 0.51
252 0.56
253 0.62
254 0.65
255 0.66
256 0.66
257 0.6
258 0.56
259 0.53
260 0.46
261 0.39