Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Z1Y5

Protein Details
Accession A0A0D1Z1Y5   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKEWKPRPKPKRKLRIGVMESDBasic
NLS Segment(s)
PositionSequence
5-15KPRPKPKRKLR
Subcellular Location(s) mito 15.5, cyto_mito 12, cyto 7.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023631  Amidase_dom  
IPR036928  AS_sf  
Pfam View protein in Pfam  
PF01425  Amidase  
Amino Acid Sequences MKEWKPRPKPKRKLRIGVMESDGVVMPHPPIIRALRATTDLLRAAGHDVIDFEPYESQKAWDIARDAARDDYKKAYLRHWNETATKTKSKQPIDVLLCPCAPSASFPHDFLPWWGYGSQFNMLDYPGVIIPVGAVDKILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.84
4 0.79
5 0.71
6 0.61
7 0.5
8 0.41
9 0.32
10 0.2
11 0.16
12 0.11
13 0.07
14 0.09
15 0.09
16 0.09
17 0.12
18 0.14
19 0.17
20 0.18
21 0.2
22 0.19
23 0.21
24 0.23
25 0.2
26 0.2
27 0.18
28 0.16
29 0.15
30 0.13
31 0.13
32 0.11
33 0.1
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.1
45 0.11
46 0.12
47 0.12
48 0.12
49 0.13
50 0.14
51 0.17
52 0.17
53 0.16
54 0.17
55 0.19
56 0.18
57 0.18
58 0.18
59 0.18
60 0.23
61 0.23
62 0.26
63 0.33
64 0.37
65 0.41
66 0.42
67 0.42
68 0.4
69 0.43
70 0.44
71 0.4
72 0.4
73 0.36
74 0.4
75 0.45
76 0.44
77 0.46
78 0.43
79 0.47
80 0.47
81 0.51
82 0.47
83 0.41
84 0.39
85 0.34
86 0.3
87 0.21
88 0.16
89 0.12
90 0.14
91 0.17
92 0.19
93 0.2
94 0.22
95 0.23
96 0.23
97 0.23
98 0.22
99 0.16
100 0.16
101 0.15
102 0.14
103 0.15
104 0.17
105 0.2
106 0.17
107 0.17
108 0.16
109 0.16
110 0.16
111 0.14
112 0.13
113 0.09
114 0.08
115 0.08
116 0.07
117 0.06
118 0.07
119 0.08
120 0.06