Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YYB4

Protein Details
Accession A0A0D1YYB4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-49SAKKHVPIVKKHPKAWRRHQSDRFMCVPTAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-17KKHPKA
Subcellular Location(s) mito 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKHPKAWRRHQSDRFMCVPTAWRKPKGIDNRVRRRFKGQIVMPSIGFGSNKKTKHMMPSGHKAFLVHNPRDVELLLMHNRTYAAEIASAVSSRKRIEIVAKAKALGVKVTNPKAKITTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.82
4 0.83
5 0.83
6 0.81
7 0.84
8 0.86
9 0.86
10 0.85
11 0.81
12 0.74
13 0.65
14 0.56
15 0.46
16 0.45
17 0.41
18 0.44
19 0.44
20 0.44
21 0.44
22 0.47
23 0.55
24 0.58
25 0.6
26 0.6
27 0.65
28 0.72
29 0.8
30 0.83
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.18
49 0.2
50 0.22
51 0.23
52 0.29
53 0.35
54 0.36
55 0.36
56 0.45
57 0.46
58 0.45
59 0.43
60 0.37
61 0.33
62 0.34
63 0.36
64 0.27
65 0.28
66 0.28
67 0.28
68 0.29
69 0.27
70 0.19
71 0.13
72 0.16
73 0.14
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.1
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.34
97 0.39
98 0.4
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.46
111 0.46