Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YT18

Protein Details
Accession A0A0D1YT18   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-122KKMDKIAAVREKRKRLKRLPNKPKGHYFRVNGBasic
NLS Segment(s)
PositionSequence
94-116DKIAAVREKRKRLKRLPNKPKGH
Subcellular Location(s) nucl 23, cyto_nucl 14.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSSPNDGDERNAAAGDPSLEIQEDGNEEIDEHQSDRIATNENEQTIMSADKSLEANMDLHENQDHGDNETSDGDKVVSSSSDTSGGVGLKKMDKIAAVREKRKRLKRLPNKPKGHYFRVNGHIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.11
5 0.09
6 0.08
7 0.08
8 0.09
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.11
18 0.11
19 0.1
20 0.1
21 0.09
22 0.1
23 0.1
24 0.1
25 0.13
26 0.12
27 0.17
28 0.19
29 0.18
30 0.18
31 0.17
32 0.17
33 0.14
34 0.14
35 0.09
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.1
52 0.1
53 0.09
54 0.1
55 0.1
56 0.11
57 0.12
58 0.12
59 0.09
60 0.09
61 0.07
62 0.06
63 0.07
64 0.06
65 0.05
66 0.06
67 0.07
68 0.08
69 0.09
70 0.09
71 0.09
72 0.09
73 0.1
74 0.09
75 0.09
76 0.1
77 0.11
78 0.12
79 0.12
80 0.11
81 0.12
82 0.14
83 0.22
84 0.3
85 0.37
86 0.45
87 0.53
88 0.63
89 0.72
90 0.8
91 0.81
92 0.82
93 0.85
94 0.88
95 0.9
96 0.92
97 0.92
98 0.92
99 0.9
100 0.9
101 0.87
102 0.85
103 0.82
104 0.77
105 0.75