Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZB15

Protein Details
Accession A0A0D1ZB15    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
239-262MMESELKKKDKKPPVVEYKIPQKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 8, mito 6, cyto 4, plas 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005612  CCAAT-binding_factor  
IPR027193  Noc4  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF03914  CBF  
Amino Acid Sequences MPAMDSYTSLISAPMTIQQRKKLLKQLQSPDTISSLRRPEILMDFFTDSLDMGDLGLAVPALQGIFHLIMSRNLDYPSFYPRLYALLDGDLLHSKYRSRVLRHLDIFLSPTNHLPAATVASFIKRLSRLCLFAPPSAIVAILPFIYNLLKTHPTTTFMIHRNPHPPYTKPGQHLGIDPYNPAEPNPQLTGAIDSSLWELETCQSHYHPTVASIARIISEQFTKQQYNLEDFLDHGYASMMESELKKKDKKPPVVEYKIPQKIFDADEHDPVSELWSFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.2
3 0.27
4 0.32
5 0.39
6 0.47
7 0.53
8 0.59
9 0.63
10 0.65
11 0.68
12 0.72
13 0.75
14 0.73
15 0.72
16 0.68
17 0.59
18 0.54
19 0.46
20 0.39
21 0.35
22 0.33
23 0.29
24 0.28
25 0.27
26 0.27
27 0.31
28 0.32
29 0.27
30 0.25
31 0.25
32 0.24
33 0.24
34 0.2
35 0.14
36 0.11
37 0.1
38 0.07
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.05
54 0.07
55 0.08
56 0.11
57 0.14
58 0.15
59 0.15
60 0.15
61 0.16
62 0.16
63 0.17
64 0.2
65 0.19
66 0.18
67 0.18
68 0.17
69 0.19
70 0.18
71 0.18
72 0.12
73 0.1
74 0.11
75 0.1
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.1
82 0.12
83 0.2
84 0.24
85 0.27
86 0.34
87 0.41
88 0.49
89 0.5
90 0.49
91 0.43
92 0.38
93 0.35
94 0.29
95 0.24
96 0.16
97 0.15
98 0.13
99 0.13
100 0.12
101 0.11
102 0.09
103 0.1
104 0.09
105 0.09
106 0.08
107 0.09
108 0.1
109 0.09
110 0.12
111 0.11
112 0.12
113 0.15
114 0.17
115 0.18
116 0.18
117 0.24
118 0.24
119 0.22
120 0.23
121 0.19
122 0.17
123 0.15
124 0.14
125 0.08
126 0.06
127 0.06
128 0.04
129 0.04
130 0.03
131 0.04
132 0.04
133 0.04
134 0.05
135 0.07
136 0.1
137 0.1
138 0.13
139 0.13
140 0.17
141 0.17
142 0.2
143 0.23
144 0.24
145 0.29
146 0.28
147 0.31
148 0.34
149 0.35
150 0.38
151 0.35
152 0.34
153 0.35
154 0.41
155 0.44
156 0.4
157 0.42
158 0.4
159 0.38
160 0.38
161 0.37
162 0.32
163 0.27
164 0.24
165 0.21
166 0.19
167 0.17
168 0.16
169 0.14
170 0.12
171 0.14
172 0.15
173 0.14
174 0.14
175 0.14
176 0.16
177 0.12
178 0.12
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.06
185 0.06
186 0.08
187 0.1
188 0.11
189 0.12
190 0.13
191 0.15
192 0.17
193 0.18
194 0.16
195 0.15
196 0.2
197 0.19
198 0.19
199 0.17
200 0.16
201 0.14
202 0.15
203 0.14
204 0.1
205 0.11
206 0.12
207 0.16
208 0.2
209 0.21
210 0.22
211 0.27
212 0.27
213 0.3
214 0.3
215 0.27
216 0.23
217 0.22
218 0.24
219 0.19
220 0.16
221 0.11
222 0.1
223 0.09
224 0.09
225 0.08
226 0.06
227 0.08
228 0.1
229 0.15
230 0.2
231 0.27
232 0.32
233 0.39
234 0.49
235 0.57
236 0.66
237 0.71
238 0.76
239 0.8
240 0.83
241 0.83
242 0.8
243 0.81
244 0.79
245 0.71
246 0.61
247 0.53
248 0.49
249 0.45
250 0.41
251 0.38
252 0.32
253 0.36
254 0.36
255 0.33
256 0.3
257 0.27
258 0.25
259 0.19