Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1X1C0

Protein Details
Accession A0A0D1X1C0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-34ESESRLRIHRQNAKRERTRFYRRKKSLFKSGYHydrophilic
NLS Segment(s)
PositionSequence
14-27NAKRERTRFYRRKK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MPESESRLRIHRQNAKRERTRFYRRKKSLFKSGYDLHKQCHAEVHILIRKNGRSYILSCAEGGKSPFSDQAMVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.81
4 0.8
5 0.78
6 0.78
7 0.8
8 0.79
9 0.8
10 0.81
11 0.8
12 0.85
13 0.87
14 0.84
15 0.84
16 0.79
17 0.71
18 0.66
19 0.63
20 0.6
21 0.58
22 0.52
23 0.42
24 0.43
25 0.41
26 0.34
27 0.32
28 0.26
29 0.2
30 0.2
31 0.25
32 0.24
33 0.24
34 0.26
35 0.26
36 0.27
37 0.27
38 0.27
39 0.23
40 0.22
41 0.22
42 0.28
43 0.28
44 0.27
45 0.26
46 0.26
47 0.24
48 0.24
49 0.24
50 0.19
51 0.17
52 0.18
53 0.2
54 0.2