Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1VNT5

Protein Details
Accession A0A0D1VNT5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
114-146STIGRAKSWWHRRNEVKPKRPRPSTKPIIYTREHydrophilic
NLS Segment(s)
PositionSequence
120-136KSWWHRRNEVKPKRPRP
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MPRFESRQALQKRVNMGRRPAASRTSSTSSNFLPPVLEEPLEECPTYNSVCSTPCQEQSDFFHQRSARDYIDEVLENSPECDEELPPYKLSEDVTVKPAYSEEPSQPDVQSPRSTIGRAKSWWHRRNEVKPKRPRPSTKPIIYTREDLEHAQTLAFYLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.64
3 0.65
4 0.65
5 0.64
6 0.64
7 0.59
8 0.56
9 0.51
10 0.47
11 0.46
12 0.43
13 0.41
14 0.38
15 0.38
16 0.34
17 0.34
18 0.31
19 0.25
20 0.21
21 0.18
22 0.19
23 0.18
24 0.16
25 0.12
26 0.14
27 0.18
28 0.19
29 0.18
30 0.15
31 0.14
32 0.16
33 0.16
34 0.14
35 0.11
36 0.11
37 0.12
38 0.13
39 0.17
40 0.18
41 0.22
42 0.25
43 0.24
44 0.25
45 0.3
46 0.38
47 0.37
48 0.34
49 0.35
50 0.33
51 0.33
52 0.35
53 0.32
54 0.24
55 0.21
56 0.21
57 0.17
58 0.17
59 0.17
60 0.14
61 0.1
62 0.1
63 0.09
64 0.08
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.07
71 0.12
72 0.13
73 0.13
74 0.14
75 0.14
76 0.14
77 0.14
78 0.16
79 0.15
80 0.15
81 0.18
82 0.18
83 0.18
84 0.17
85 0.17
86 0.14
87 0.13
88 0.14
89 0.13
90 0.17
91 0.19
92 0.21
93 0.2
94 0.22
95 0.22
96 0.24
97 0.24
98 0.21
99 0.22
100 0.23
101 0.24
102 0.24
103 0.27
104 0.28
105 0.28
106 0.34
107 0.41
108 0.5
109 0.56
110 0.59
111 0.64
112 0.68
113 0.77
114 0.81
115 0.82
116 0.81
117 0.85
118 0.89
119 0.9
120 0.91
121 0.9
122 0.87
123 0.87
124 0.88
125 0.85
126 0.83
127 0.81
128 0.77
129 0.72
130 0.67
131 0.59
132 0.53
133 0.47
134 0.39
135 0.36
136 0.32
137 0.28
138 0.24
139 0.21