Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YST9

Protein Details
Accession A0A0D1YST9   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
349-370FVTNWKRHEKGKKMFNLVDRKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, pero 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006140  D-isomer_DH_NAD-bd  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0051287  F:NAD binding  
Pfam View protein in Pfam  
PF02826  2-Hacid_dh_C  
CDD cd12163  2-Hacid_dh_5  
Amino Acid Sequences MGGGPDKEHLVIAHWDPEPKHETSLIKQLFPYIDITYVQVSRNLEPAVDNSDQISDDLWKSATILLTLFTLPSTKDKVPNLKLIHLFSAGVDAWSNHPIVKDSDIAITTSSGIHGPPITEWIVMTTLVASRNYKLQYEWQKQHDWSSKRNVLQSGTDWAGKTVGIAGYGSIGRQAARVFTALGASVHAYTAGPRSTPSARKDNGYFVPGTGDPDGSIPMAWYSGTDKTSLHTFLASGLDALIISLPLTPATRHLFGAEEFRILGSSGSSKAKAAGQKAFLINIARGPILDQKALITALNDEVLAGAALDVTDPEPLPKDDPLWDAKNVIITPHVSGLGSEYSDRAYDLFVTNWKRHEKGKKMFNLVDRKKGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.27
4 0.33
5 0.34
6 0.31
7 0.32
8 0.31
9 0.34
10 0.34
11 0.44
12 0.41
13 0.38
14 0.37
15 0.38
16 0.34
17 0.31
18 0.3
19 0.2
20 0.19
21 0.18
22 0.19
23 0.18
24 0.19
25 0.19
26 0.2
27 0.21
28 0.21
29 0.24
30 0.23
31 0.2
32 0.19
33 0.2
34 0.23
35 0.21
36 0.2
37 0.16
38 0.17
39 0.17
40 0.16
41 0.15
42 0.12
43 0.12
44 0.13
45 0.12
46 0.11
47 0.11
48 0.13
49 0.13
50 0.1
51 0.1
52 0.09
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.09
59 0.12
60 0.17
61 0.19
62 0.25
63 0.31
64 0.4
65 0.44
66 0.51
67 0.5
68 0.51
69 0.52
70 0.48
71 0.44
72 0.35
73 0.31
74 0.23
75 0.22
76 0.16
77 0.13
78 0.11
79 0.09
80 0.11
81 0.12
82 0.12
83 0.1
84 0.11
85 0.12
86 0.14
87 0.15
88 0.14
89 0.14
90 0.16
91 0.15
92 0.15
93 0.14
94 0.12
95 0.1
96 0.09
97 0.09
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.09
105 0.1
106 0.09
107 0.09
108 0.09
109 0.1
110 0.09
111 0.09
112 0.06
113 0.07
114 0.09
115 0.11
116 0.1
117 0.1
118 0.15
119 0.17
120 0.17
121 0.17
122 0.24
123 0.33
124 0.41
125 0.46
126 0.46
127 0.49
128 0.49
129 0.57
130 0.57
131 0.5
132 0.47
133 0.5
134 0.52
135 0.5
136 0.52
137 0.46
138 0.39
139 0.37
140 0.33
141 0.28
142 0.23
143 0.22
144 0.19
145 0.17
146 0.15
147 0.13
148 0.11
149 0.08
150 0.07
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.06
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.04
176 0.04
177 0.06
178 0.06
179 0.06
180 0.06
181 0.1
182 0.14
183 0.2
184 0.24
185 0.3
186 0.3
187 0.33
188 0.35
189 0.36
190 0.34
191 0.3
192 0.26
193 0.18
194 0.2
195 0.17
196 0.18
197 0.13
198 0.11
199 0.09
200 0.1
201 0.1
202 0.07
203 0.07
204 0.05
205 0.05
206 0.05
207 0.04
208 0.05
209 0.06
210 0.09
211 0.1
212 0.1
213 0.1
214 0.11
215 0.14
216 0.15
217 0.13
218 0.1
219 0.1
220 0.1
221 0.11
222 0.1
223 0.07
224 0.06
225 0.06
226 0.05
227 0.05
228 0.04
229 0.03
230 0.03
231 0.03
232 0.03
233 0.04
234 0.05
235 0.05
236 0.09
237 0.13
238 0.14
239 0.14
240 0.15
241 0.16
242 0.16
243 0.22
244 0.18
245 0.15
246 0.13
247 0.13
248 0.13
249 0.12
250 0.11
251 0.06
252 0.07
253 0.1
254 0.12
255 0.12
256 0.12
257 0.14
258 0.18
259 0.21
260 0.24
261 0.26
262 0.26
263 0.3
264 0.31
265 0.3
266 0.28
267 0.25
268 0.21
269 0.18
270 0.17
271 0.12
272 0.12
273 0.13
274 0.17
275 0.18
276 0.18
277 0.16
278 0.15
279 0.17
280 0.17
281 0.16
282 0.1
283 0.09
284 0.09
285 0.1
286 0.09
287 0.07
288 0.07
289 0.07
290 0.06
291 0.04
292 0.03
293 0.03
294 0.03
295 0.03
296 0.04
297 0.04
298 0.05
299 0.05
300 0.07
301 0.09
302 0.11
303 0.14
304 0.15
305 0.16
306 0.18
307 0.22
308 0.27
309 0.28
310 0.28
311 0.27
312 0.26
313 0.29
314 0.27
315 0.24
316 0.2
317 0.17
318 0.18
319 0.18
320 0.18
321 0.13
322 0.13
323 0.15
324 0.14
325 0.14
326 0.13
327 0.12
328 0.12
329 0.13
330 0.13
331 0.1
332 0.1
333 0.11
334 0.12
335 0.14
336 0.2
337 0.26
338 0.3
339 0.36
340 0.41
341 0.42
342 0.5
343 0.58
344 0.62
345 0.65
346 0.72
347 0.75
348 0.77
349 0.81
350 0.81
351 0.81
352 0.78