Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YKQ5

Protein Details
Accession A0A0D1YKQ5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-39EGSNTATSPPRKRKWHPKTFTGCLRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPIVHKQIQDDNSEGSNTATSPPRKRKWHPKTFTGCLRCKSRRIKCDETHPGCLRCAKASLPCPGYKPPTARLFEPRSGPQFDSLDDELNYKHFVHVGSAFLSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.16
4 0.13
5 0.14
6 0.19
7 0.24
8 0.33
9 0.43
10 0.51
11 0.59
12 0.68
13 0.77
14 0.8
15 0.85
16 0.83
17 0.83
18 0.83
19 0.82
20 0.81
21 0.78
22 0.72
23 0.67
24 0.69
25 0.63
26 0.63
27 0.65
28 0.65
29 0.65
30 0.68
31 0.71
32 0.66
33 0.72
34 0.75
35 0.69
36 0.68
37 0.63
38 0.55
39 0.48
40 0.47
41 0.37
42 0.27
43 0.24
44 0.17
45 0.19
46 0.21
47 0.26
48 0.27
49 0.27
50 0.29
51 0.32
52 0.35
53 0.34
54 0.33
55 0.34
56 0.39
57 0.4
58 0.4
59 0.44
60 0.46
61 0.45
62 0.47
63 0.45
64 0.42
65 0.43
66 0.41
67 0.37
68 0.32
69 0.29
70 0.31
71 0.27
72 0.25
73 0.22
74 0.22
75 0.18
76 0.19
77 0.2
78 0.14
79 0.14
80 0.13
81 0.13
82 0.16
83 0.17
84 0.17
85 0.17