Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZH74

Protein Details
Accession A0A0D1ZH74   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
263-287MEAKAAKGTKKTKGKKSNKGAVIGGHydrophilic
NLS Segment(s)
PositionSequence
246-290GDRWLAWRRRAARVKAAMEAKAAKGTKKTKGKKSNKGAVIGGKKR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MKGIKNIKLLYTTSNTANMLQPRLYRSALSADASLAALASSLNTLSLCAKHKPLQPQSVSTIFVRHASHAQQGRANGPGDSAGRRLGAKKSASEYVVPGNIIFKQRGTKWHPGDNVGIGKDHTIFATESGYVRYYRDPLKHPKRRYIGVALEKEGPGSQLPLPRNAPSRRRLGMFATPLKQQDADQDFMEAHLAGNTNSVSTFKSGAATPTPPPTITRQGTYREANVSIGMAAERKGVKVREFDRGDRWLAWRRRAARVKAAMEAKAAKGTKKTKGKKSNKGAVIGGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.29
4 0.33
5 0.32
6 0.3
7 0.3
8 0.3
9 0.31
10 0.34
11 0.33
12 0.28
13 0.26
14 0.28
15 0.27
16 0.26
17 0.23
18 0.19
19 0.18
20 0.18
21 0.15
22 0.1
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.06
32 0.08
33 0.12
34 0.15
35 0.18
36 0.23
37 0.29
38 0.35
39 0.44
40 0.51
41 0.57
42 0.56
43 0.57
44 0.57
45 0.53
46 0.5
47 0.4
48 0.34
49 0.26
50 0.27
51 0.24
52 0.2
53 0.21
54 0.21
55 0.28
56 0.3
57 0.31
58 0.3
59 0.31
60 0.31
61 0.31
62 0.29
63 0.22
64 0.17
65 0.17
66 0.16
67 0.16
68 0.15
69 0.13
70 0.13
71 0.14
72 0.17
73 0.18
74 0.22
75 0.23
76 0.24
77 0.27
78 0.29
79 0.29
80 0.27
81 0.25
82 0.22
83 0.21
84 0.19
85 0.15
86 0.13
87 0.14
88 0.15
89 0.14
90 0.13
91 0.16
92 0.18
93 0.26
94 0.31
95 0.38
96 0.4
97 0.47
98 0.47
99 0.45
100 0.45
101 0.4
102 0.36
103 0.27
104 0.23
105 0.17
106 0.16
107 0.14
108 0.12
109 0.09
110 0.08
111 0.07
112 0.07
113 0.08
114 0.08
115 0.07
116 0.08
117 0.09
118 0.08
119 0.09
120 0.1
121 0.12
122 0.16
123 0.19
124 0.24
125 0.34
126 0.45
127 0.53
128 0.56
129 0.62
130 0.62
131 0.61
132 0.59
133 0.54
134 0.51
135 0.49
136 0.47
137 0.4
138 0.37
139 0.34
140 0.3
141 0.24
142 0.17
143 0.09
144 0.1
145 0.1
146 0.13
147 0.14
148 0.18
149 0.2
150 0.22
151 0.29
152 0.33
153 0.38
154 0.37
155 0.43
156 0.41
157 0.42
158 0.41
159 0.38
160 0.38
161 0.38
162 0.37
163 0.33
164 0.33
165 0.32
166 0.31
167 0.28
168 0.22
169 0.24
170 0.23
171 0.23
172 0.2
173 0.2
174 0.19
175 0.18
176 0.19
177 0.11
178 0.07
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.06
185 0.07
186 0.07
187 0.07
188 0.08
189 0.1
190 0.09
191 0.1
192 0.1
193 0.13
194 0.15
195 0.16
196 0.17
197 0.2
198 0.21
199 0.2
200 0.22
201 0.25
202 0.32
203 0.31
204 0.33
205 0.33
206 0.37
207 0.42
208 0.42
209 0.4
210 0.34
211 0.32
212 0.29
213 0.26
214 0.2
215 0.15
216 0.12
217 0.1
218 0.08
219 0.07
220 0.1
221 0.1
222 0.11
223 0.16
224 0.19
225 0.22
226 0.29
227 0.32
228 0.38
229 0.43
230 0.45
231 0.46
232 0.47
233 0.47
234 0.42
235 0.44
236 0.44
237 0.46
238 0.5
239 0.52
240 0.53
241 0.61
242 0.68
243 0.68
244 0.68
245 0.7
246 0.66
247 0.65
248 0.64
249 0.55
250 0.5
251 0.46
252 0.38
253 0.36
254 0.35
255 0.3
256 0.35
257 0.4
258 0.46
259 0.54
260 0.62
261 0.66
262 0.76
263 0.84
264 0.86
265 0.9
266 0.91
267 0.86
268 0.82
269 0.76
270 0.74