Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YF94

Protein Details
Accession A0A0D1YF94    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAATSGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
9-24GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 17, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATSGGKKQKKKWSKGKVKDKAQHAVVLDKATSDKLNKDVQSYRLVTVAVLVDRLKINGSLARRALADLEDRGVIRKVVQHSSGSIYTRVGASTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.92
8 0.92
9 0.89
10 0.85
11 0.81
12 0.72
13 0.65
14 0.55
15 0.48
16 0.38
17 0.32
18 0.25
19 0.18
20 0.16
21 0.13
22 0.14
23 0.12
24 0.12
25 0.14
26 0.2
27 0.2
28 0.23
29 0.25
30 0.26
31 0.3
32 0.3
33 0.26
34 0.22
35 0.21
36 0.17
37 0.15
38 0.13
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.08
48 0.1
49 0.12
50 0.15
51 0.16
52 0.16
53 0.16
54 0.16
55 0.16
56 0.14
57 0.15
58 0.11
59 0.12
60 0.12
61 0.12
62 0.14
63 0.14
64 0.13
65 0.12
66 0.16
67 0.19
68 0.23
69 0.25
70 0.25
71 0.26
72 0.31
73 0.33
74 0.3
75 0.27
76 0.23
77 0.22
78 0.21