Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1W4F6

Protein Details
Accession A0A0D1W4F6    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
538-588SDGPPRGKRFQDKDEKREHKRKVKEEKREKRATKMPKNVKKKLVKDSAKRRBasic
NLS Segment(s)
PositionSequence
542-588PRGKRFQDKDEKREHKRKVKEEKREKRATKMPKNVKKKLVKDSAKRR
Subcellular Location(s) nucl 20, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000687  RIO_kinase  
IPR018935  RIO_kinase_CS  
IPR017407  Ser/Thr_kinase_Rio1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0046872  F:metal ion binding  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF01163  RIO1  
PROSITE View protein in PROSITE  
PS01245  RIO1  
CDD cd05147  RIO1_euk  
Amino Acid Sequences MASGDSNNQGSGVSTSESRAGIADGLAPSHVYVPNQGYAGSDATKTGRRLASGKLIQEDDDEEEDEEDDDEYDYDDNIDDAQLADPDFLASSNPADLTKSYNRQRRLDHAAADSNVPSWQYPKGNPQKVSNADVDLGHAMKKLKIEGLESLPAGQHKGKDKSDRATSEQVLDPKTRRILFQMINSGIVSEINGTISTGKEANVYHAVSASEEPDTPDTQVAIKVYKTSILVFKDREKYVTGEFRFRKGFNKGDNRAMVKLWAEKEMRNLKRIHAAGIPCPEPLYLRRHVLGMSFIGDSKGKAAPRLKDVAFEDENPTARWRSVYIDILAYMRILLQQCKLVHADLSEYNMLYHRNKPYIIDVSQSVEGDHPRSLDFLRMDIKNVSDFFRRQGVSVLSDKKAFMLITRQTKGDGSDLEMDALRQEIDKVMAERTDDEQDDEVENEVFRKQYIPQTLDDVYDAEKDAEQMKTAGRDTLVYKDLLAPSRDEKRQALSLEEDDAATELDRDENRGAPLERGGTHSSSDSGDDRSDAGSDSESDGPPRGKRFQDKDEKREHKRKVKEEKREKRATKMPKNVKKKLVKDSAKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.16
5 0.15
6 0.15
7 0.14
8 0.12
9 0.12
10 0.14
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.13
17 0.15
18 0.12
19 0.16
20 0.18
21 0.21
22 0.21
23 0.21
24 0.19
25 0.19
26 0.21
27 0.18
28 0.15
29 0.14
30 0.17
31 0.23
32 0.23
33 0.28
34 0.27
35 0.29
36 0.31
37 0.34
38 0.41
39 0.41
40 0.44
41 0.41
42 0.41
43 0.38
44 0.37
45 0.34
46 0.27
47 0.24
48 0.21
49 0.17
50 0.16
51 0.16
52 0.15
53 0.13
54 0.1
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.1
83 0.11
84 0.16
85 0.23
86 0.32
87 0.4
88 0.47
89 0.54
90 0.59
91 0.63
92 0.65
93 0.66
94 0.62
95 0.58
96 0.55
97 0.53
98 0.48
99 0.45
100 0.37
101 0.28
102 0.24
103 0.2
104 0.15
105 0.12
106 0.16
107 0.18
108 0.21
109 0.31
110 0.41
111 0.49
112 0.52
113 0.55
114 0.59
115 0.59
116 0.61
117 0.52
118 0.43
119 0.36
120 0.32
121 0.28
122 0.21
123 0.17
124 0.13
125 0.14
126 0.13
127 0.14
128 0.15
129 0.15
130 0.16
131 0.16
132 0.18
133 0.19
134 0.22
135 0.22
136 0.21
137 0.2
138 0.19
139 0.18
140 0.19
141 0.16
142 0.17
143 0.23
144 0.29
145 0.34
146 0.42
147 0.47
148 0.51
149 0.58
150 0.57
151 0.55
152 0.55
153 0.51
154 0.46
155 0.44
156 0.41
157 0.35
158 0.35
159 0.31
160 0.29
161 0.34
162 0.31
163 0.28
164 0.29
165 0.34
166 0.33
167 0.36
168 0.39
169 0.34
170 0.34
171 0.33
172 0.29
173 0.21
174 0.18
175 0.13
176 0.06
177 0.06
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.07
184 0.07
185 0.07
186 0.09
187 0.09
188 0.12
189 0.15
190 0.15
191 0.14
192 0.14
193 0.14
194 0.13
195 0.13
196 0.11
197 0.08
198 0.08
199 0.1
200 0.11
201 0.11
202 0.11
203 0.11
204 0.1
205 0.1
206 0.11
207 0.11
208 0.1
209 0.1
210 0.1
211 0.1
212 0.11
213 0.12
214 0.12
215 0.15
216 0.17
217 0.2
218 0.21
219 0.27
220 0.32
221 0.31
222 0.31
223 0.29
224 0.28
225 0.29
226 0.35
227 0.31
228 0.34
229 0.35
230 0.37
231 0.38
232 0.37
233 0.38
234 0.35
235 0.39
236 0.39
237 0.48
238 0.47
239 0.5
240 0.53
241 0.51
242 0.46
243 0.4
244 0.33
245 0.24
246 0.24
247 0.19
248 0.2
249 0.19
250 0.19
251 0.27
252 0.35
253 0.36
254 0.37
255 0.37
256 0.33
257 0.39
258 0.38
259 0.33
260 0.27
261 0.26
262 0.25
263 0.27
264 0.26
265 0.19
266 0.19
267 0.17
268 0.14
269 0.16
270 0.17
271 0.17
272 0.18
273 0.18
274 0.19
275 0.19
276 0.18
277 0.16
278 0.11
279 0.1
280 0.08
281 0.08
282 0.08
283 0.08
284 0.08
285 0.08
286 0.11
287 0.09
288 0.14
289 0.18
290 0.2
291 0.23
292 0.28
293 0.26
294 0.27
295 0.28
296 0.29
297 0.26
298 0.25
299 0.24
300 0.21
301 0.22
302 0.19
303 0.19
304 0.14
305 0.13
306 0.13
307 0.11
308 0.13
309 0.15
310 0.16
311 0.16
312 0.15
313 0.16
314 0.15
315 0.14
316 0.11
317 0.07
318 0.05
319 0.07
320 0.07
321 0.08
322 0.09
323 0.13
324 0.14
325 0.16
326 0.16
327 0.14
328 0.14
329 0.13
330 0.15
331 0.11
332 0.13
333 0.12
334 0.11
335 0.11
336 0.11
337 0.14
338 0.14
339 0.18
340 0.2
341 0.21
342 0.22
343 0.23
344 0.26
345 0.29
346 0.27
347 0.24
348 0.21
349 0.21
350 0.22
351 0.21
352 0.17
353 0.13
354 0.13
355 0.13
356 0.13
357 0.11
358 0.1
359 0.11
360 0.11
361 0.14
362 0.14
363 0.14
364 0.18
365 0.18
366 0.2
367 0.19
368 0.2
369 0.18
370 0.18
371 0.19
372 0.18
373 0.19
374 0.19
375 0.24
376 0.24
377 0.22
378 0.24
379 0.23
380 0.23
381 0.28
382 0.3
383 0.26
384 0.27
385 0.26
386 0.23
387 0.23
388 0.19
389 0.14
390 0.17
391 0.22
392 0.29
393 0.31
394 0.31
395 0.3
396 0.31
397 0.31
398 0.27
399 0.2
400 0.16
401 0.18
402 0.18
403 0.18
404 0.17
405 0.15
406 0.13
407 0.12
408 0.09
409 0.05
410 0.06
411 0.06
412 0.07
413 0.09
414 0.1
415 0.11
416 0.11
417 0.12
418 0.14
419 0.16
420 0.18
421 0.17
422 0.17
423 0.17
424 0.17
425 0.18
426 0.16
427 0.14
428 0.11
429 0.11
430 0.1
431 0.1
432 0.09
433 0.08
434 0.09
435 0.12
436 0.18
437 0.25
438 0.27
439 0.27
440 0.32
441 0.33
442 0.32
443 0.29
444 0.23
445 0.17
446 0.16
447 0.15
448 0.11
449 0.1
450 0.11
451 0.13
452 0.12
453 0.12
454 0.12
455 0.13
456 0.16
457 0.16
458 0.17
459 0.14
460 0.16
461 0.18
462 0.22
463 0.22
464 0.18
465 0.18
466 0.21
467 0.24
468 0.26
469 0.25
470 0.23
471 0.27
472 0.35
473 0.37
474 0.37
475 0.35
476 0.36
477 0.41
478 0.39
479 0.37
480 0.33
481 0.32
482 0.3
483 0.29
484 0.24
485 0.18
486 0.17
487 0.14
488 0.1
489 0.08
490 0.06
491 0.1
492 0.1
493 0.13
494 0.15
495 0.17
496 0.18
497 0.22
498 0.23
499 0.21
500 0.23
501 0.23
502 0.23
503 0.25
504 0.27
505 0.24
506 0.24
507 0.24
508 0.22
509 0.2
510 0.22
511 0.19
512 0.18
513 0.17
514 0.16
515 0.16
516 0.15
517 0.15
518 0.13
519 0.12
520 0.11
521 0.12
522 0.15
523 0.17
524 0.17
525 0.18
526 0.22
527 0.25
528 0.28
529 0.33
530 0.36
531 0.41
532 0.51
533 0.57
534 0.63
535 0.71
536 0.76
537 0.8
538 0.84
539 0.86
540 0.87
541 0.89
542 0.89
543 0.88
544 0.88
545 0.89
546 0.9
547 0.9
548 0.91
549 0.92
550 0.93
551 0.93
552 0.94
553 0.88
554 0.86
555 0.85
556 0.85
557 0.85
558 0.85
559 0.85
560 0.85
561 0.91
562 0.9
563 0.91
564 0.9
565 0.88
566 0.88
567 0.87
568 0.87