Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YLN5

Protein Details
Accession A0A0D1YLN5    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
128-149TGTKMKEERKRHVQARKTQTLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013963  DASH_Dad2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08654  DASH_Dad2  
Amino Acid Sequences MSYAQRPTNIYPTSSKSSLTNHTSTSISSLRQPSQSLLQTRINAKRAELDNLRQLRDLSANLASQLSTLEAKLTTLRDGTQSVALVLANWENVLRAISMAAMKVPRPSAQDQDGADADVEGGDEGDSTGTKMKEERKRHVQARKTQTLPVPLVRIPVQPKEEGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.33
4 0.37
5 0.41
6 0.42
7 0.38
8 0.33
9 0.34
10 0.33
11 0.31
12 0.31
13 0.25
14 0.2
15 0.24
16 0.27
17 0.28
18 0.3
19 0.31
20 0.28
21 0.32
22 0.37
23 0.34
24 0.34
25 0.36
26 0.38
27 0.43
28 0.47
29 0.45
30 0.4
31 0.37
32 0.39
33 0.36
34 0.39
35 0.36
36 0.33
37 0.37
38 0.4
39 0.4
40 0.34
41 0.32
42 0.27
43 0.25
44 0.22
45 0.16
46 0.14
47 0.13
48 0.13
49 0.13
50 0.11
51 0.09
52 0.09
53 0.07
54 0.06
55 0.05
56 0.06
57 0.05
58 0.06
59 0.07
60 0.08
61 0.07
62 0.08
63 0.08
64 0.09
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.08
71 0.07
72 0.06
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.06
89 0.07
90 0.09
91 0.1
92 0.11
93 0.15
94 0.18
95 0.21
96 0.23
97 0.27
98 0.25
99 0.27
100 0.26
101 0.22
102 0.19
103 0.15
104 0.12
105 0.07
106 0.07
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.04
113 0.04
114 0.04
115 0.09
116 0.09
117 0.1
118 0.14
119 0.23
120 0.33
121 0.41
122 0.49
123 0.56
124 0.66
125 0.74
126 0.8
127 0.8
128 0.8
129 0.83
130 0.83
131 0.75
132 0.71
133 0.67
134 0.64
135 0.59
136 0.53
137 0.47
138 0.39
139 0.4
140 0.37
141 0.38
142 0.36
143 0.39
144 0.38
145 0.36