Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YHW9

Protein Details
Accession A0A0D1YHW9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-120LDKPFPPGEKKRAMKKQQRRPSRPGEPYPRPEBasic
NLS Segment(s)
PositionSequence
95-113PGEKKRAMKKQQRRPSRPG
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MSSGGAALQPTFQGHVATTQDALILFEACLQGHLSHVPRRPHDRERSSLIRSGSVFIYEENASGIKRWTDGVTWSPSRILGNFLVYRELDKPFPPGEKKRAMKKQQRRPSRPGEPYPRPEANSFSDGQAPGFGADRNASEIERQLIGSLVDSYGFKADGLVKKTMSVTVQGVTHHLVSYYHLNDVMSNQLRTPSQTENLQYIRPRTELISKQSFRSPIEDVDEVEGAPSAYGYRVNTGGYMQNNTQQAQYYMPQNYPPMAQQPGAPGYGMGVPSMPAPYLQSPVSAPPMQGQRPDYNQYDQTAYNRGYDPSSRSLPATPTSMPSMMPDRGQPQPGGMYPPMSMQRPMNNLSPVSMESRNPVPYRSSPYPVNTSAPQMDHTRQNQPSPNQVKYEDRRESGQQPSQTYQSPRTPYYPEAAGQPMQQPQYSQPPQMAQWTPQPHPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.18
4 0.18
5 0.18
6 0.16
7 0.16
8 0.16
9 0.16
10 0.12
11 0.1
12 0.09
13 0.1
14 0.11
15 0.1
16 0.1
17 0.11
18 0.1
19 0.11
20 0.17
21 0.19
22 0.26
23 0.33
24 0.4
25 0.46
26 0.55
27 0.62
28 0.67
29 0.73
30 0.73
31 0.73
32 0.74
33 0.74
34 0.69
35 0.66
36 0.58
37 0.51
38 0.45
39 0.41
40 0.33
41 0.27
42 0.22
43 0.17
44 0.19
45 0.15
46 0.14
47 0.13
48 0.13
49 0.11
50 0.12
51 0.14
52 0.11
53 0.12
54 0.13
55 0.14
56 0.15
57 0.18
58 0.22
59 0.27
60 0.28
61 0.29
62 0.28
63 0.28
64 0.28
65 0.25
66 0.23
67 0.17
68 0.21
69 0.22
70 0.22
71 0.23
72 0.22
73 0.24
74 0.23
75 0.24
76 0.2
77 0.19
78 0.22
79 0.22
80 0.29
81 0.35
82 0.4
83 0.46
84 0.54
85 0.6
86 0.66
87 0.74
88 0.78
89 0.81
90 0.83
91 0.86
92 0.87
93 0.91
94 0.89
95 0.87
96 0.87
97 0.86
98 0.85
99 0.83
100 0.84
101 0.81
102 0.79
103 0.78
104 0.72
105 0.64
106 0.56
107 0.51
108 0.45
109 0.39
110 0.34
111 0.28
112 0.27
113 0.25
114 0.23
115 0.19
116 0.15
117 0.12
118 0.12
119 0.1
120 0.08
121 0.08
122 0.08
123 0.1
124 0.11
125 0.1
126 0.1
127 0.12
128 0.13
129 0.13
130 0.12
131 0.1
132 0.1
133 0.09
134 0.09
135 0.08
136 0.06
137 0.06
138 0.06
139 0.07
140 0.07
141 0.07
142 0.06
143 0.07
144 0.12
145 0.16
146 0.19
147 0.21
148 0.2
149 0.21
150 0.22
151 0.22
152 0.17
153 0.15
154 0.13
155 0.12
156 0.13
157 0.13
158 0.14
159 0.13
160 0.13
161 0.11
162 0.1
163 0.08
164 0.09
165 0.13
166 0.13
167 0.12
168 0.12
169 0.12
170 0.12
171 0.12
172 0.17
173 0.15
174 0.14
175 0.14
176 0.15
177 0.16
178 0.17
179 0.2
180 0.16
181 0.16
182 0.19
183 0.2
184 0.22
185 0.24
186 0.25
187 0.24
188 0.24
189 0.23
190 0.21
191 0.2
192 0.18
193 0.23
194 0.25
195 0.29
196 0.36
197 0.35
198 0.36
199 0.39
200 0.39
201 0.33
202 0.32
203 0.27
204 0.19
205 0.21
206 0.2
207 0.17
208 0.16
209 0.15
210 0.12
211 0.1
212 0.09
213 0.05
214 0.05
215 0.04
216 0.03
217 0.03
218 0.05
219 0.05
220 0.06
221 0.07
222 0.07
223 0.07
224 0.08
225 0.11
226 0.11
227 0.13
228 0.12
229 0.16
230 0.18
231 0.18
232 0.18
233 0.15
234 0.15
235 0.15
236 0.16
237 0.16
238 0.16
239 0.16
240 0.17
241 0.18
242 0.17
243 0.16
244 0.15
245 0.14
246 0.15
247 0.14
248 0.14
249 0.16
250 0.17
251 0.16
252 0.15
253 0.11
254 0.1
255 0.12
256 0.11
257 0.08
258 0.06
259 0.06
260 0.06
261 0.07
262 0.06
263 0.05
264 0.07
265 0.08
266 0.1
267 0.1
268 0.1
269 0.11
270 0.13
271 0.17
272 0.16
273 0.15
274 0.17
275 0.23
276 0.23
277 0.26
278 0.29
279 0.28
280 0.32
281 0.36
282 0.35
283 0.33
284 0.34
285 0.32
286 0.31
287 0.28
288 0.26
289 0.26
290 0.24
291 0.23
292 0.22
293 0.21
294 0.21
295 0.22
296 0.24
297 0.24
298 0.26
299 0.24
300 0.25
301 0.26
302 0.26
303 0.26
304 0.25
305 0.21
306 0.2
307 0.22
308 0.21
309 0.19
310 0.19
311 0.21
312 0.19
313 0.19
314 0.19
315 0.2
316 0.24
317 0.26
318 0.23
319 0.2
320 0.22
321 0.22
322 0.24
323 0.21
324 0.19
325 0.17
326 0.21
327 0.23
328 0.22
329 0.23
330 0.21
331 0.26
332 0.29
333 0.32
334 0.33
335 0.32
336 0.31
337 0.3
338 0.29
339 0.24
340 0.25
341 0.24
342 0.2
343 0.2
344 0.24
345 0.29
346 0.28
347 0.28
348 0.29
349 0.31
350 0.4
351 0.42
352 0.42
353 0.41
354 0.45
355 0.5
356 0.47
357 0.47
358 0.39
359 0.39
360 0.38
361 0.34
362 0.32
363 0.31
364 0.32
365 0.36
366 0.39
367 0.44
368 0.44
369 0.5
370 0.55
371 0.54
372 0.6
373 0.59
374 0.59
375 0.54
376 0.54
377 0.57
378 0.56
379 0.63
380 0.59
381 0.54
382 0.55
383 0.57
384 0.59
385 0.58
386 0.58
387 0.53
388 0.51
389 0.52
390 0.51
391 0.52
392 0.51
393 0.49
394 0.5
395 0.5
396 0.49
397 0.49
398 0.5
399 0.47
400 0.47
401 0.42
402 0.36
403 0.34
404 0.35
405 0.32
406 0.3
407 0.32
408 0.33
409 0.32
410 0.31
411 0.29
412 0.3
413 0.39
414 0.41
415 0.39
416 0.37
417 0.38
418 0.4
419 0.46
420 0.45
421 0.37
422 0.42
423 0.47
424 0.46