Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BGN1

Protein Details
Accession Q6BGN1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
138-215VLSGARKRHSRDKRERKERKMERKRKEKERIRKREEDIRKREEKIRKREEKEKIRKREKREKRERKRAEEKREKERAABasic
NLS Segment(s)
PositionSequence
142-226ARKRHSRDKRERKERKMERKRKEKERIRKREEDIRKREEKIRKREEKEKIRKREKREKRERKRAEEKREKERAALMPKRRMPMRP
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
KEGG dha:DEHA2G25102g  -  
Amino Acid Sequences MLMEIPRIDYNRAVTSPGPTPVPTLEPSAAPSPVLSRSPSPVPVPPAVSEPPAPSRSVPVSAPDAPPVSVSWNDSSLSPNHASSPYVHQLPGYLPPFSPPYHAPVAPYHAPASSGFALPPQDTYLGAPLYDAHVSREVLSGARKRHSRDKRERKERKMERKRKEKERIRKREEDIRKREEKIRKREEKEKIRKREKREKRERKRAEEKREKERAALMPKRRMPMRPVNKSTRQAIGSPNAESECRGSSPQASCVQKQPPCSRSLVSPRPSGFQRRHEHPGPCPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.3
4 0.3
5 0.28
6 0.23
7 0.25
8 0.24
9 0.27
10 0.24
11 0.25
12 0.23
13 0.21
14 0.25
15 0.25
16 0.23
17 0.2
18 0.18
19 0.16
20 0.18
21 0.2
22 0.19
23 0.18
24 0.23
25 0.26
26 0.29
27 0.3
28 0.31
29 0.34
30 0.34
31 0.34
32 0.31
33 0.32
34 0.3
35 0.29
36 0.27
37 0.25
38 0.28
39 0.27
40 0.27
41 0.24
42 0.26
43 0.27
44 0.27
45 0.25
46 0.22
47 0.26
48 0.28
49 0.28
50 0.26
51 0.24
52 0.22
53 0.22
54 0.19
55 0.17
56 0.15
57 0.16
58 0.15
59 0.16
60 0.16
61 0.16
62 0.17
63 0.15
64 0.19
65 0.18
66 0.17
67 0.17
68 0.18
69 0.18
70 0.18
71 0.24
72 0.23
73 0.23
74 0.22
75 0.2
76 0.2
77 0.21
78 0.26
79 0.21
80 0.17
81 0.16
82 0.18
83 0.2
84 0.2
85 0.22
86 0.15
87 0.18
88 0.21
89 0.22
90 0.22
91 0.21
92 0.26
93 0.25
94 0.25
95 0.21
96 0.17
97 0.18
98 0.16
99 0.19
100 0.14
101 0.13
102 0.11
103 0.12
104 0.13
105 0.12
106 0.12
107 0.09
108 0.08
109 0.08
110 0.08
111 0.09
112 0.08
113 0.08
114 0.07
115 0.07
116 0.08
117 0.08
118 0.08
119 0.07
120 0.09
121 0.1
122 0.1
123 0.11
124 0.09
125 0.09
126 0.13
127 0.16
128 0.17
129 0.21
130 0.24
131 0.27
132 0.37
133 0.46
134 0.53
135 0.6
136 0.69
137 0.75
138 0.84
139 0.91
140 0.89
141 0.91
142 0.9
143 0.91
144 0.91
145 0.9
146 0.89
147 0.9
148 0.9
149 0.9
150 0.9
151 0.89
152 0.89
153 0.9
154 0.91
155 0.88
156 0.87
157 0.81
158 0.8
159 0.81
160 0.81
161 0.78
162 0.75
163 0.72
164 0.67
165 0.71
166 0.7
167 0.69
168 0.69
169 0.72
170 0.73
171 0.75
172 0.81
173 0.82
174 0.84
175 0.86
176 0.85
177 0.85
178 0.86
179 0.88
180 0.88
181 0.89
182 0.88
183 0.89
184 0.9
185 0.9
186 0.91
187 0.94
188 0.94
189 0.94
190 0.94
191 0.93
192 0.92
193 0.92
194 0.88
195 0.87
196 0.86
197 0.77
198 0.68
199 0.64
200 0.6
201 0.59
202 0.61
203 0.58
204 0.58
205 0.62
206 0.66
207 0.63
208 0.59
209 0.57
210 0.59
211 0.62
212 0.63
213 0.67
214 0.7
215 0.75
216 0.76
217 0.72
218 0.67
219 0.59
220 0.51
221 0.48
222 0.47
223 0.41
224 0.36
225 0.35
226 0.3
227 0.28
228 0.26
229 0.23
230 0.18
231 0.17
232 0.18
233 0.17
234 0.22
235 0.25
236 0.3
237 0.35
238 0.37
239 0.38
240 0.44
241 0.51
242 0.48
243 0.55
244 0.59
245 0.54
246 0.53
247 0.54
248 0.49
249 0.5
250 0.57
251 0.57
252 0.53
253 0.57
254 0.55
255 0.57
256 0.61
257 0.61
258 0.58
259 0.59
260 0.62
261 0.61
262 0.68
263 0.7
264 0.71