Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D0G3

Protein Details
Accession A0A0D0D0G3   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32WNDDFKLFKFRKKREKKESERDVYLIHydrophilic
NLS Segment(s)
PositionSequence
16-23FRKKREKK
Subcellular Location(s) mito 8cyto 8cyto_mito 8, nucl 7
Family & Domain DBs
Amino Acid Sequences MAYVCGWNDDFKLFKFRKKREKKESERDVYLICMHQVVSLFLGKIDRRARNRSISGPLSRYQVMADGPVRMLRNLEIPWSMLPFGHQPFQDDSCFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.52
4 0.6
5 0.7
6 0.79
7 0.8
8 0.89
9 0.92
10 0.92
11 0.93
12 0.89
13 0.81
14 0.72
15 0.61
16 0.52
17 0.43
18 0.32
19 0.22
20 0.15
21 0.11
22 0.1
23 0.1
24 0.08
25 0.08
26 0.08
27 0.07
28 0.07
29 0.09
30 0.09
31 0.15
32 0.2
33 0.25
34 0.29
35 0.35
36 0.39
37 0.43
38 0.45
39 0.43
40 0.43
41 0.41
42 0.4
43 0.37
44 0.35
45 0.32
46 0.3
47 0.27
48 0.21
49 0.17
50 0.14
51 0.15
52 0.14
53 0.11
54 0.11
55 0.14
56 0.15
57 0.13
58 0.14
59 0.12
60 0.15
61 0.15
62 0.16
63 0.14
64 0.15
65 0.16
66 0.17
67 0.16
68 0.12
69 0.14
70 0.17
71 0.19
72 0.23
73 0.22
74 0.24
75 0.28
76 0.31