Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0ASA6

Protein Details
Accession A0A0D0ASA6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-35LVEADSKKERKRKRERGSSGKSKGIBasic
NLS Segment(s)
PositionSequence
17-40KKERKRKRERGSSGKSKGISKRRK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSDFDDELLELVEADSKKERKRKRERGSSGKSKGISKRRKADVSDDDPESEEEEEDPYPLDGKYVDEADMQRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.17
3 0.22
4 0.29
5 0.38
6 0.46
7 0.53
8 0.65
9 0.74
10 0.78
11 0.85
12 0.88
13 0.9
14 0.91
15 0.9
16 0.84
17 0.78
18 0.69
19 0.63
20 0.62
21 0.61
22 0.61
23 0.58
24 0.61
25 0.62
26 0.65
27 0.61
28 0.61
29 0.59
30 0.56
31 0.52
32 0.45
33 0.39
34 0.36
35 0.34
36 0.27
37 0.19
38 0.13
39 0.09
40 0.1
41 0.1
42 0.09
43 0.09
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.09
50 0.12
51 0.12
52 0.13
53 0.15
54 0.17