Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0CSC9

Protein Details
Accession A0A0D0CSC9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-77SRSGRKQKARTVRERRKMKVARKPIWRERKGNBasic
NLS Segment(s)
PositionSequence
47-75RSGRKQKARTVRERRKMKVARKPIWRERK
Subcellular Location(s) mito 16, mito_nucl 13, nucl 8
Family & Domain DBs
Amino Acid Sequences MILFTTRTTIENRIKKTLHRPARSEDVSLLSASLSAFFTASSTIASRSGRKQKARTVRERRKMKVARKPIWRERKGNEMWTDQEVNPRSWDSIDSLTLSPIFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.62
4 0.64
5 0.65
6 0.64
7 0.64
8 0.62
9 0.7
10 0.65
11 0.57
12 0.47
13 0.4
14 0.34
15 0.3
16 0.23
17 0.13
18 0.12
19 0.1
20 0.09
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.06
30 0.06
31 0.09
32 0.1
33 0.12
34 0.19
35 0.28
36 0.34
37 0.4
38 0.43
39 0.49
40 0.58
41 0.64
42 0.68
43 0.7
44 0.74
45 0.78
46 0.82
47 0.78
48 0.78
49 0.79
50 0.77
51 0.76
52 0.76
53 0.74
54 0.76
55 0.82
56 0.82
57 0.84
58 0.82
59 0.79
60 0.71
61 0.73
62 0.67
63 0.65
64 0.59
65 0.52
66 0.47
67 0.45
68 0.45
69 0.36
70 0.4
71 0.35
72 0.32
73 0.31
74 0.29
75 0.26
76 0.23
77 0.24
78 0.19
79 0.2
80 0.2
81 0.21
82 0.2
83 0.2