Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CNQ8

Protein Details
Accession A0A0D0CNQ8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-123DERPMPRGPLFPRRRRRRPRRTNTTDQNSGGBasic
NLS Segment(s)
PositionSequence
99-113RGPLFPRRRRRRPRR
Subcellular Location(s) mito 10, nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MQTPTSPLAATGSSKPLFPKGVTCPPPAKSDLMRMYTLQHAESGLGNDYLKRKNVIRVRLEGEQFLLQARDVPDVVDWIEGLHAAANIALDLDERPMPRGPLFPRRRRRRPRRTNTTDQNSGGARTVAASAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.26
4 0.27
5 0.25
6 0.28
7 0.29
8 0.39
9 0.42
10 0.45
11 0.46
12 0.45
13 0.48
14 0.45
15 0.41
16 0.33
17 0.38
18 0.39
19 0.37
20 0.36
21 0.33
22 0.33
23 0.33
24 0.32
25 0.23
26 0.17
27 0.14
28 0.14
29 0.14
30 0.12
31 0.09
32 0.09
33 0.09
34 0.1
35 0.14
36 0.15
37 0.16
38 0.17
39 0.18
40 0.25
41 0.31
42 0.38
43 0.38
44 0.4
45 0.42
46 0.44
47 0.43
48 0.35
49 0.3
50 0.23
51 0.19
52 0.15
53 0.11
54 0.07
55 0.08
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.05
80 0.07
81 0.08
82 0.11
83 0.12
84 0.14
85 0.14
86 0.2
87 0.24
88 0.33
89 0.43
90 0.51
91 0.61
92 0.71
93 0.81
94 0.86
95 0.92
96 0.93
97 0.94
98 0.95
99 0.96
100 0.94
101 0.94
102 0.94
103 0.92
104 0.87
105 0.77
106 0.7
107 0.6
108 0.52
109 0.43
110 0.32
111 0.23
112 0.16