Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CUS7

Protein Details
Accession A0A0D0CUS7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-58LGWFCPRSKVEHKRSQRFNLVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 4, extr 3, cyto_pero 3, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSWALAKYHTNKRLSPVTPHYILGYGCIPAAFLLFVLGWFCPRSKVEHKRSQRFNLVCNQLAVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.5
4 0.49
5 0.47
6 0.46
7 0.4
8 0.34
9 0.31
10 0.24
11 0.18
12 0.12
13 0.1
14 0.09
15 0.08
16 0.06
17 0.06
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.04
25 0.05
26 0.06
27 0.06
28 0.08
29 0.09
30 0.16
31 0.26
32 0.37
33 0.46
34 0.56
35 0.66
36 0.74
37 0.81
38 0.83
39 0.83
40 0.75
41 0.7
42 0.69
43 0.66
44 0.58