Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0CEX9

Protein Details
Accession A0A0D0CEX9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
222-252RDDYYDSRRRHPSRSRSPASRHYKIRPRSVYHydrophilic
NLS Segment(s)
PositionSequence
231-238RHPSRSRS
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPSAVSTSLIGRSLKGRKSLPTLRATALRLSRKTNAFDVVYSDIPRANAPGNWVHVSTVDLRIINEVRNYTFIPLSPPHLLSPRNVKISLKANSFQARGDHKDARDDEGFDISPTTSSQAQNSGSRYYDWDVQPSPPSPDRYAPRTYDDSYGCEDLEGWRHIRSRSPHHRNCSKDPDTHYSERSSQTHTSPVGFPRSQSPRSHMRKDRHYAGYLDRQYDYRRDDYYDSRRRHPSRSRSPASRHYKIRPRSVYYSDDYFEASVPLSVSGSDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.4
4 0.42
5 0.51
6 0.59
7 0.58
8 0.57
9 0.57
10 0.53
11 0.55
12 0.52
13 0.5
14 0.49
15 0.5
16 0.46
17 0.48
18 0.51
19 0.51
20 0.53
21 0.49
22 0.46
23 0.39
24 0.36
25 0.35
26 0.31
27 0.29
28 0.26
29 0.24
30 0.2
31 0.19
32 0.19
33 0.17
34 0.15
35 0.13
36 0.16
37 0.18
38 0.22
39 0.23
40 0.23
41 0.21
42 0.19
43 0.2
44 0.19
45 0.19
46 0.16
47 0.15
48 0.15
49 0.18
50 0.19
51 0.19
52 0.19
53 0.17
54 0.16
55 0.18
56 0.19
57 0.17
58 0.17
59 0.15
60 0.17
61 0.17
62 0.2
63 0.2
64 0.21
65 0.21
66 0.24
67 0.25
68 0.24
69 0.32
70 0.33
71 0.34
72 0.34
73 0.33
74 0.34
75 0.41
76 0.44
77 0.38
78 0.34
79 0.35
80 0.37
81 0.38
82 0.34
83 0.3
84 0.3
85 0.31
86 0.35
87 0.35
88 0.31
89 0.37
90 0.37
91 0.37
92 0.33
93 0.3
94 0.25
95 0.22
96 0.22
97 0.15
98 0.15
99 0.1
100 0.09
101 0.08
102 0.09
103 0.1
104 0.1
105 0.11
106 0.13
107 0.15
108 0.18
109 0.19
110 0.19
111 0.17
112 0.17
113 0.18
114 0.17
115 0.21
116 0.18
117 0.19
118 0.19
119 0.19
120 0.21
121 0.2
122 0.22
123 0.19
124 0.22
125 0.21
126 0.26
127 0.28
128 0.31
129 0.34
130 0.32
131 0.33
132 0.34
133 0.34
134 0.33
135 0.3
136 0.27
137 0.26
138 0.25
139 0.2
140 0.16
141 0.14
142 0.11
143 0.13
144 0.13
145 0.11
146 0.13
147 0.16
148 0.16
149 0.22
150 0.26
151 0.33
152 0.43
153 0.52
154 0.57
155 0.64
156 0.72
157 0.73
158 0.76
159 0.75
160 0.68
161 0.63
162 0.62
163 0.6
164 0.59
165 0.56
166 0.5
167 0.43
168 0.43
169 0.42
170 0.38
171 0.36
172 0.31
173 0.3
174 0.32
175 0.3
176 0.28
177 0.26
178 0.28
179 0.3
180 0.27
181 0.27
182 0.31
183 0.37
184 0.39
185 0.39
186 0.4
187 0.44
188 0.52
189 0.61
190 0.61
191 0.62
192 0.68
193 0.73
194 0.77
195 0.72
196 0.67
197 0.6
198 0.58
199 0.59
200 0.52
201 0.47
202 0.4
203 0.37
204 0.37
205 0.39
206 0.38
207 0.32
208 0.3
209 0.31
210 0.34
211 0.41
212 0.49
213 0.53
214 0.52
215 0.56
216 0.65
217 0.65
218 0.71
219 0.72
220 0.72
221 0.74
222 0.8
223 0.82
224 0.8
225 0.84
226 0.85
227 0.84
228 0.82
229 0.79
230 0.78
231 0.79
232 0.79
233 0.82
234 0.79
235 0.77
236 0.76
237 0.73
238 0.69
239 0.64
240 0.6
241 0.51
242 0.43
243 0.37
244 0.3
245 0.25
246 0.2
247 0.15
248 0.11
249 0.11
250 0.1
251 0.09