Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CBM7

Protein Details
Accession A0A0D0CBM7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-109VTLVNRKRLRRQFMNPYIPHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 8.5, cyto_mito 6.666, cyto_nucl 3.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLRQIQWIVLLWFGLVGWVVSAPLPADFTLELNSLASVAAESNPPVQSLSEAEQPLIVVSPVAVTTTETATGDGNGNSDGVQSEVRELEVTLVNRKRLRRQFMNPYIPHYKVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.07
22 0.07
23 0.06
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.1
36 0.12
37 0.14
38 0.14
39 0.13
40 0.13
41 0.13
42 0.12
43 0.1
44 0.08
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.06
65 0.07
66 0.06
67 0.06
68 0.07
69 0.06
70 0.07
71 0.08
72 0.08
73 0.08
74 0.08
75 0.09
76 0.13
77 0.14
78 0.21
79 0.25
80 0.31
81 0.36
82 0.41
83 0.49
84 0.54
85 0.62
86 0.63
87 0.69
88 0.74
89 0.8
90 0.86
91 0.77
92 0.76
93 0.73