Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0C6N2

Protein Details
Accession A0A0D0C6N2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
130-155CLVTCTKYGTCPKCKRKAGEMEHNTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 9.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041078  Plavaka  
Pfam View protein in Pfam  
PF18759  Plavaka  
Amino Acid Sequences LIPISGTIAPVIIASDKTQLTHFSGSKSAYPVYLTLGNIPKSIRRKPNSRSCVLIAYLSVDKVSKDGLSKSALRVRNYELFHRSMAIVLESLKAAGNPGRGGVELIGGDGAVRRVYPILTAYVADYPEQCLVTCTKYGTCPKCKRKAGEMEHNTPGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.12
3 0.13
4 0.14
5 0.15
6 0.17
7 0.19
8 0.24
9 0.24
10 0.23
11 0.26
12 0.27
13 0.28
14 0.28
15 0.25
16 0.2
17 0.2
18 0.17
19 0.17
20 0.18
21 0.16
22 0.19
23 0.23
24 0.23
25 0.24
26 0.24
27 0.27
28 0.31
29 0.39
30 0.43
31 0.45
32 0.53
33 0.61
34 0.71
35 0.72
36 0.68
37 0.64
38 0.57
39 0.53
40 0.45
41 0.36
42 0.25
43 0.21
44 0.19
45 0.14
46 0.12
47 0.09
48 0.08
49 0.08
50 0.09
51 0.06
52 0.07
53 0.08
54 0.1
55 0.13
56 0.14
57 0.17
58 0.23
59 0.27
60 0.27
61 0.28
62 0.3
63 0.33
64 0.34
65 0.34
66 0.3
67 0.27
68 0.26
69 0.25
70 0.21
71 0.15
72 0.13
73 0.1
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.07
83 0.08
84 0.07
85 0.08
86 0.08
87 0.08
88 0.09
89 0.08
90 0.07
91 0.06
92 0.06
93 0.05
94 0.04
95 0.04
96 0.04
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.07
105 0.09
106 0.09
107 0.1
108 0.1
109 0.12
110 0.12
111 0.12
112 0.11
113 0.12
114 0.13
115 0.13
116 0.12
117 0.12
118 0.13
119 0.15
120 0.16
121 0.16
122 0.16
123 0.23
124 0.32
125 0.39
126 0.48
127 0.56
128 0.65
129 0.74
130 0.8
131 0.8
132 0.8
133 0.83
134 0.82
135 0.82
136 0.81
137 0.77