Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C522

Protein Details
Accession A0A0D0C522   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-137QATIRRSKKIRADPVHRKPPLRBasic
NLS Segment(s)
PositionSequence
123-125KKI
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010998  Integrase_recombinase_N  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MEKVLLDALGEQKRSTQCSAHPAMDLKELDTLVHFLQSHSIEKSTKQNYSTGVRDYICFCTIHNLPLDATPTTLSRYIAFTSKHIASGPKYLSGARHYLKQFYPHFDVSRSDPLVQATIRRSKKIRADPVHRKPPLRILHIELAYSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.29
4 0.28
5 0.36
6 0.41
7 0.36
8 0.36
9 0.35
10 0.34
11 0.36
12 0.33
13 0.25
14 0.23
15 0.21
16 0.18
17 0.16
18 0.16
19 0.1
20 0.13
21 0.12
22 0.1
23 0.14
24 0.16
25 0.17
26 0.17
27 0.19
28 0.17
29 0.2
30 0.28
31 0.29
32 0.3
33 0.29
34 0.3
35 0.32
36 0.36
37 0.37
38 0.3
39 0.29
40 0.26
41 0.25
42 0.26
43 0.25
44 0.21
45 0.18
46 0.15
47 0.17
48 0.17
49 0.18
50 0.16
51 0.14
52 0.13
53 0.14
54 0.16
55 0.11
56 0.1
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.09
63 0.1
64 0.11
65 0.13
66 0.14
67 0.13
68 0.17
69 0.16
70 0.16
71 0.16
72 0.17
73 0.15
74 0.2
75 0.2
76 0.17
77 0.18
78 0.18
79 0.19
80 0.2
81 0.24
82 0.2
83 0.25
84 0.25
85 0.29
86 0.3
87 0.35
88 0.35
89 0.36
90 0.4
91 0.37
92 0.37
93 0.35
94 0.36
95 0.33
96 0.37
97 0.33
98 0.28
99 0.26
100 0.26
101 0.27
102 0.25
103 0.24
104 0.22
105 0.3
106 0.32
107 0.37
108 0.39
109 0.44
110 0.54
111 0.6
112 0.65
113 0.65
114 0.73
115 0.79
116 0.86
117 0.89
118 0.85
119 0.78
120 0.71
121 0.71
122 0.68
123 0.64
124 0.58
125 0.54
126 0.57
127 0.55