Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BU65

Protein Details
Accession Q6BU65    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-80ANDRIRQSKEKQKKFEQRRKESEEELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG dha:DEHA2C13244g  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLDRNRFDPCEKLMDALEECHRQEFMKKALGMCNFEKEELTKCLHYTRVNDANDRIRQSKEKQKKFEQRRKESEEELYGKNNYLKRMIEKEAESRGKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.28
4 0.29
5 0.26
6 0.25
7 0.26
8 0.23
9 0.23
10 0.22
11 0.22
12 0.19
13 0.22
14 0.24
15 0.23
16 0.26
17 0.27
18 0.28
19 0.33
20 0.35
21 0.36
22 0.32
23 0.33
24 0.27
25 0.26
26 0.25
27 0.2
28 0.21
29 0.19
30 0.2
31 0.16
32 0.16
33 0.17
34 0.2
35 0.21
36 0.2
37 0.25
38 0.3
39 0.3
40 0.31
41 0.33
42 0.36
43 0.37
44 0.37
45 0.33
46 0.28
47 0.31
48 0.36
49 0.44
50 0.48
51 0.54
52 0.58
53 0.67
54 0.75
55 0.82
56 0.85
57 0.86
58 0.85
59 0.86
60 0.86
61 0.81
62 0.74
63 0.68
64 0.65
65 0.59
66 0.51
67 0.45
68 0.38
69 0.35
70 0.36
71 0.34
72 0.29
73 0.29
74 0.3
75 0.33
76 0.38
77 0.4
78 0.41
79 0.42
80 0.45
81 0.51