Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C6Z2

Protein Details
Accession A0A0D0C6Z2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-55QETSLKRSLKCSKPRNPFILAHydrophilic
183-208VNEVEAGEKRRKRKKRKVEDADAIFEBasic
NLS Segment(s)
PositionSequence
190-199EKRRKRKKRK
Subcellular Location(s) cyto 14.5, cyto_nucl 14, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MNPSTGSSFHSRTDEFEKAGLFPFTEAYPLKFILQETSLKRSLKCSKPRNPFILAEAEEDDSEEEDGFVVPDRVDLGEEEDKAFERYLVKELSDYASTEAPAPASDGTLRMLKDADGFWVPSLFDDIEACEGMTVSPDMVSPLSPIHESESLKSSTEMDGEGEEEGEGEGEGEEAAKVAKVAVNEVEAGEKRRKRKKRKVEDADAIFEANPEVKVDPSLAAFYEQLRKIQYEHPGPTFLWNFMTFHVRCHKGYEKAIIRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.32
4 0.3
5 0.26
6 0.28
7 0.24
8 0.18
9 0.14
10 0.14
11 0.13
12 0.16
13 0.16
14 0.15
15 0.17
16 0.18
17 0.19
18 0.19
19 0.19
20 0.18
21 0.2
22 0.24
23 0.25
24 0.3
25 0.35
26 0.36
27 0.36
28 0.41
29 0.48
30 0.52
31 0.58
32 0.62
33 0.67
34 0.76
35 0.83
36 0.8
37 0.76
38 0.68
39 0.6
40 0.57
41 0.49
42 0.4
43 0.33
44 0.29
45 0.23
46 0.22
47 0.19
48 0.12
49 0.11
50 0.08
51 0.06
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.06
63 0.11
64 0.13
65 0.14
66 0.14
67 0.14
68 0.14
69 0.15
70 0.15
71 0.11
72 0.1
73 0.11
74 0.14
75 0.14
76 0.14
77 0.13
78 0.14
79 0.15
80 0.14
81 0.13
82 0.11
83 0.11
84 0.11
85 0.12
86 0.11
87 0.08
88 0.08
89 0.08
90 0.06
91 0.06
92 0.06
93 0.06
94 0.08
95 0.1
96 0.1
97 0.09
98 0.1
99 0.09
100 0.1
101 0.1
102 0.1
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.08
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.06
131 0.06
132 0.07
133 0.09
134 0.12
135 0.13
136 0.14
137 0.17
138 0.16
139 0.17
140 0.17
141 0.15
142 0.12
143 0.12
144 0.11
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.05
167 0.05
168 0.06
169 0.07
170 0.08
171 0.08
172 0.08
173 0.11
174 0.11
175 0.15
176 0.22
177 0.26
178 0.34
179 0.44
180 0.55
181 0.63
182 0.73
183 0.81
184 0.85
185 0.92
186 0.93
187 0.93
188 0.92
189 0.85
190 0.78
191 0.68
192 0.57
193 0.45
194 0.34
195 0.25
196 0.16
197 0.11
198 0.08
199 0.08
200 0.08
201 0.09
202 0.1
203 0.1
204 0.1
205 0.11
206 0.1
207 0.11
208 0.11
209 0.13
210 0.2
211 0.21
212 0.22
213 0.23
214 0.24
215 0.26
216 0.3
217 0.37
218 0.37
219 0.41
220 0.41
221 0.42
222 0.41
223 0.45
224 0.41
225 0.34
226 0.3
227 0.26
228 0.24
229 0.23
230 0.31
231 0.24
232 0.28
233 0.36
234 0.36
235 0.36
236 0.43
237 0.49
238 0.48
239 0.53
240 0.58
241 0.57