Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BWH1

Protein Details
Accession A0A0D0BWH1    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-39TAEKIKDKKTYKKWRDDIQHSEHydrophilic
50-81HVKSRMTKARTRKQTHRRSAEKENMRRMRRNABasic
NLS Segment(s)
PositionSequence
42-83GKRKRNIYHVKSRMTKARTRKQTHRRSAEKENMRRMRRNAIK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MMENVNNLSKTVDRRSETAEKIKDKKTYKKWRDDIQHSEEEGKRKRNIYHVKSRMTKARTRKQTHRRSAEKENMRRMRRNAIKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.48
4 0.49
5 0.53
6 0.53
7 0.53
8 0.57
9 0.61
10 0.61
11 0.61
12 0.66
13 0.68
14 0.72
15 0.74
16 0.78
17 0.8
18 0.8
19 0.83
20 0.81
21 0.77
22 0.72
23 0.67
24 0.57
25 0.54
26 0.48
27 0.45
28 0.41
29 0.38
30 0.35
31 0.34
32 0.35
33 0.41
34 0.49
35 0.49
36 0.56
37 0.58
38 0.63
39 0.65
40 0.67
41 0.65
42 0.59
43 0.59
44 0.58
45 0.61
46 0.64
47 0.67
48 0.74
49 0.77
50 0.83
51 0.87
52 0.87
53 0.86
54 0.83
55 0.84
56 0.84
57 0.84
58 0.82
59 0.82
60 0.81
61 0.8
62 0.81
63 0.76
64 0.76
65 0.75