Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CF17

Protein Details
Accession A0A0D0CF17   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-41YIDYRGLKKKIRKEKPQHLATESHydrophilic
NLS Segment(s)
PositionSequence
26-33KKKIRKEK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004331  SPX_dom  
Pfam View protein in Pfam  
PF03105  SPX  
PROSITE View protein in PROSITE  
PS51382  SPX  
Amino Acid Sequences MKFAKYLSQTQTPEWKKAYIDYRGLKKKIRKEKPQHLATESQVHLPASPETSHFPGEQADGGPSTSRARHDAGMGLGELPVRKRSVATRRGSQSSAPDSSQSSSHRKLSVSGAKGPRSQTSRGFLARGTPLFAIQYFIITDSNIASQFYISQTATLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.39
4 0.44
5 0.47
6 0.43
7 0.47
8 0.49
9 0.56
10 0.63
11 0.66
12 0.67
13 0.67
14 0.71
15 0.73
16 0.76
17 0.77
18 0.79
19 0.86
20 0.88
21 0.88
22 0.83
23 0.76
24 0.69
25 0.61
26 0.58
27 0.48
28 0.39
29 0.33
30 0.28
31 0.24
32 0.21
33 0.19
34 0.13
35 0.13
36 0.13
37 0.14
38 0.16
39 0.17
40 0.16
41 0.16
42 0.14
43 0.14
44 0.13
45 0.11
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.14
56 0.14
57 0.15
58 0.15
59 0.13
60 0.13
61 0.11
62 0.09
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.15
72 0.23
73 0.32
74 0.36
75 0.41
76 0.45
77 0.48
78 0.49
79 0.43
80 0.39
81 0.35
82 0.33
83 0.27
84 0.23
85 0.22
86 0.21
87 0.23
88 0.22
89 0.24
90 0.26
91 0.29
92 0.3
93 0.29
94 0.3
95 0.35
96 0.38
97 0.35
98 0.39
99 0.42
100 0.43
101 0.46
102 0.46
103 0.44
104 0.41
105 0.41
106 0.38
107 0.37
108 0.39
109 0.38
110 0.37
111 0.31
112 0.31
113 0.33
114 0.28
115 0.25
116 0.2
117 0.19
118 0.2
119 0.19
120 0.17
121 0.12
122 0.13
123 0.1
124 0.11
125 0.11
126 0.1
127 0.1
128 0.09
129 0.11
130 0.1
131 0.1
132 0.09
133 0.09
134 0.11
135 0.12
136 0.14
137 0.13