Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0B6Q6

Protein Details
Accession A0A0D0B6Q6   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29SYSLVRQATVPRNRKRRRYRTFITCICFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 6, extr 4, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences LSYSLVRQATVPRNRKRRRYRTFITCICFLAGLRSLSAVDHQESLSTRTKLLQNLSYHLTNPEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.83
3 0.86
4 0.88
5 0.87
6 0.87
7 0.86
8 0.85
9 0.86
10 0.81
11 0.74
12 0.64
13 0.55
14 0.46
15 0.37
16 0.27
17 0.19
18 0.15
19 0.11
20 0.1
21 0.09
22 0.09
23 0.09
24 0.1
25 0.1
26 0.08
27 0.09
28 0.09
29 0.1
30 0.11
31 0.15
32 0.2
33 0.19
34 0.19
35 0.22
36 0.26
37 0.28
38 0.32
39 0.35
40 0.31
41 0.35
42 0.39
43 0.37
44 0.34