Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BW30

Protein Details
Accession A0A0D0BW30   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-66SPTAPAKRGRGRPKGSKNKKNPSSSGHydrophilic
72-115STSAVPRKRGRPPKPKNPDESEGEPTPKRKRGRPPKAKPEGGEDBasic
NLS Segment(s)
PositionSequence
45-128PAKRGRGRPKGSKNKKNPSSSGATAGPSTSAVPRKRGRPPKPKNPDESEGEPTPKRKRGRPPKAKPEGGEDEPVKRKRGRPPKN
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSSAELDNANKANDRDDDELDDVQDSGEQDDGNHAGNEGSPTAPAKRGRGRPKGSKNKKNPSSSGATAGPSTSAVPRKRGRPPKPKNPDESEGEPTPKRKRGRPPKAKPEGGEDEPVKRKRGRPPKNAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.27
4 0.27
5 0.29
6 0.28
7 0.28
8 0.25
9 0.23
10 0.18
11 0.14
12 0.13
13 0.1
14 0.08
15 0.08
16 0.07
17 0.07
18 0.09
19 0.1
20 0.1
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.08
30 0.09
31 0.14
32 0.16
33 0.21
34 0.28
35 0.37
36 0.46
37 0.55
38 0.61
39 0.66
40 0.75
41 0.8
42 0.83
43 0.85
44 0.86
45 0.87
46 0.88
47 0.83
48 0.74
49 0.67
50 0.62
51 0.53
52 0.47
53 0.36
54 0.29
55 0.24
56 0.21
57 0.16
58 0.11
59 0.1
60 0.09
61 0.15
62 0.16
63 0.23
64 0.27
65 0.33
66 0.43
67 0.53
68 0.6
69 0.65
70 0.74
71 0.78
72 0.85
73 0.86
74 0.84
75 0.8
76 0.75
77 0.7
78 0.65
79 0.6
80 0.52
81 0.5
82 0.44
83 0.43
84 0.46
85 0.47
86 0.47
87 0.49
88 0.57
89 0.64
90 0.73
91 0.79
92 0.82
93 0.86
94 0.91
95 0.89
96 0.8
97 0.77
98 0.74
99 0.66
100 0.62
101 0.53
102 0.51
103 0.54
104 0.55
105 0.52
106 0.5
107 0.53
108 0.57
109 0.66
110 0.69
111 0.7